RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G025890
Reference: TK1151 Chr: Chr08 Coordinates: 6616593-6624910 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1435 bp · TkA08G025890|TK1151|cDNA

CTAGAATCTCTAGTAGTTAGCTGGGCTTCTGAATTATATGTTGCATTTACCCAAAGGACAAAGACTTTCACTCTTACCAAAGAGTCCCACCAAAATTCCATTTTCTCACTGCTTATCTACTTGATCACACATACGCACTCGATTCCCAAATTCCGCCATGGATGATGACAGCGATCGGAGCTCTGAAGCAACTCAACTGGAAGGACATTCAACAGCGGAGGATACGACGATGCACCCTCATTTCGACGATGGCGCTACTC...

CDS

Download CDS FASTA

1059 bp · TkA08G025890|TK1151|CDS

ATGGATGATGACAGCGATCGGAGCTCTGAAGCAACTCAACTGGAAGGACATTCAACAGCGGAGGATACGACGATGCACCCTCATTTCGACGATGGCGCTACTCCATTACATACTTCTCCTACGTCACCCGAGGAAGATTCAACTACTTCCCAACCTTTAACCCTAGTAGTATCCGATTTATCAGACGTACCGGTAAAATACGAGATGCAACGCGATGAGTTGGAGCGCTTGAAGAATCAGCTTCAAGGGAGTCACCAAGA...

Protein

Download Protein FASTA

352 aa · TkA08G025890|TK1151|PROTEIN

MDDDSDRSSEATQLEGHSTAEDTTMHPHFDDGATPLHTSPTSPEEDSTTSQPLTLVVSDLSDVPVKYEMQRDELERLKNQLQGSHQEALATVIAQAARSQISSLKCSNPQAQNHSQKNTTDYPKSSSPSHHVKIPTDGYNWRKYGQKQVKSPQGSRSYYKCTSTECDAKKIESCDQNNYVTKVVYKGHHKHDPPKKVFSGGKILSSPKSLKRKPISTPPLKEHRLCDQRVKNSVPKKPKFIVHAADDVGISADGYRWRKY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G025890
TK1151 IDTkA08G025890
OH-1004 IDLXL04_018125
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.900
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G025890
LocationChr08:6616593-6624910 (+)
DescriptionSimilar to WRKY32: Probable WRKY transcription factor 32
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g30935 Transcription factor. No verified direct reference in this release
At1g13960 Transcription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis- acting element.
Roles of Arabidopsis WRKY3 and WRKY4 transcription factors in plant responses to pathogens.2008 · DOI: 10.1186/1471-2229-8-68
Structural basis for sequence-specific DNA recognition by an Arabidopsis WRKY transcription factor.2012 · DOI: 10.1074/jbc.m111.279844
At5g07100 Transcription factor.
Arabidopsis thaliana WRKY25, WRKY26, and WRKY33 coordinate induction of plant thermotolerance.2011 · DOI: 10.1007/s00425-011-1375-2
At3g01080 Transcription factor. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0826400 May participate in transcriptional regulation of abscisic acid and gibberellin signaling.
Annotations and functional analyses of the rice WRKY gene superfamily reveal positive and negative regulators of abscisic acid signaling in aleurone cells.2005 · DOI: 10.1104/pp.104.054312
A negative regulator encoded by a rice WRKY gene represses both abscisic acid and gibberellins signaling in aleurone cells.2009 · DOI: 10.1007/s11103-009-9463-4
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_018125 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0034605 cellular response to heat Biological Process
GO:0070370 cellular heat acclimation Biological Process
GO:0005634 nucleus Cellular Component
GO:0000976 transcription cis-regulatory region binding Molecular Function
GO:0003700 DNA-binding transcription factor activity Molecular Function
GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference
ath:AT4G30935
ath:AT5G07100
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.936
Rank 1 · TkA08G025890 · TK1151
Cytoplasm0.168
Rank 2 · TkA08G025890 · TK1151
Mitochondrion0.024
Rank 3 · TkA08G025890 · TK1151
Cell membrane0.018
Rank 4 · TkA08G025890 · TK1151
Endoplasmic reticulum0.007
Rank 5 · TkA08G025890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19677DUF617966-121 aa
PF21524SAMD1_WH70-92 aa
PF11776RcnB129-147 aa
PF03106WRKY137-192 aa
PF07828PA-IL140-160 aa
PF23549Zn_ribbon_GRF_2154-167 aa
PF21524SAMD1_WH159-188 aa
PF07828PA-IL239-278 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G025890PF19677DUF6179661210.01415.3
TkA08G025890PF21524SAMD1_WH70920.05614.3
TkA08G025890PF11776RcnB1291470.1712.5
TkA08G025890PF03106WRKY1371922.2e-41140.6
TkA08G025890PF07828PA-IL1401600.2312.2
TkA08G025890PF23549Zn_ribbon_GRF_21541670.9810.0
TkA08G025890PF21524SAMD1_WH1591880.05614.3
TkA08G025890PF07828PA-IL2392780.2312.2
TkA08G025890PF03106WRKY2533092.2e-41140.6
TkA08G025890PF11776RcnB2532650.1712.5
TkA08G025890PF23549Zn_ribbon_GRF_22722800.9810.0
TkA08G025890PF21524SAMD1_WH2843040.05614.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
P59583Arabidopsis thalianasp|P59583|WRK32_ARATH Probable WRKY transcription factor 3245.600%Swiss-ProtMedium
Q9XI90Arabidopsis thalianasp|Q9XI90|WRKY4_ARATH Probable WRKY transcription factor 432.500%Swiss-ProtMedium
Q9C5T3Arabidopsis thalianasp|Q9C5T3|WRK26_ARATH Probable WRKY transcription factor 2643.600%Swiss-ProtMedium
Q93WU7Arabidopsis thalianasp|Q93WU7|WRK58_ARATH Probable WRKY transcription factor 5836.700%Swiss-ProtMedium
Q6IEQ7Oryza sativa subsp. japonicasp|Q6IEQ7|WRK24_ORYSJ WRKY transcription factor WRKY2435.200%Swiss-ProtMedium

JBrowse

View in Genome Browser