TkA07G058760 | RubberDandelionOmics

Gene overview

TkA07G058760

Reference: TK1151 Chr: Chr07 Coordinates: 15559432-15564210 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2562 bp · TkA07G058760|TK1151|cDNA

CAGAACGATGAATCTATAACCAGCAGTAGCTTTCATCTATGACTGTTATAAAGAAATTCAAAAAAAGCATTTTATATCTGATTACTTTAATTTGCTCATTTGACTTATCTTGTCTGCGGATCTTCAAGAACTGCAGCTGATTGATCTCTAATAATTTCACACCATAACCCCTTTCATCTCTATCTTCTCCTCTTCCCCACCAAACTCTTTACCTCTGCAACAATGGCGGCAAGGAAACCTCCATCCGTACTGTTTCTAAC...

CDS

Download CDS FASTA

1152 bp · TkA07G058760|TK1151|CDS

ATGGCAAAACTTCCTCACCTTCGATCCTTTGATGTTGCTTATAATCTCTTACAAGGCACAATACCGCCTGAATGGGGTTTAACACAGTTGCATGACATCTCGCTTCTTGGAAACCGGATAACAGGAGAAATTCCACCCGAAATAGGCAATATCACCACTCTCACTAGGCTGGACCTTGAAGCAAACCATCTTTCCGGAACTATTCCGCCTGATTTAGGAAAATTAATCAATTTGCAATCTTTGATATTGTCATCAAACCA...

Protein

Download Protein FASTA

383 aa · TkA07G058760|TK1151|PROTEIN

MAKLPHLRSFDVAYNLLQGTIPPEWGLTQLHDISLLGNRITGEIPPEIGNITTLTRLDLEANHLSGTIPPDLGKLINLQSLILSSNQFTGRLPIALGQLGNLTNFRINENNFSGPIPDFIQNWKLLSRLELMASGLTGPIPPSISLLENLLDLRISDISGPSQQFPPINNATGLIRLILRNCNISGEIPDYIWRVRELEMFDASFNNLVGRISNNILGRSIRYVFLTSNMLSGDIPENLLVNGASVDLSYNNFTWQEPDE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G058760`
TK1151 ID	TkA07G058760
OH-1004 ID	LXL04_027433
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 38.531 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G058760

Location Chr07:15559432-15564210 (-)

Description Similar to RKF1: Probable LRR receptor-like serine/threonine-protein kinase RFK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g29750`	Probable LRR receptor-like serine/threonine-protein kinase RFK1.	No verified direct reference in this release
`At1g29720`	Probable LRR receptor-like serine/threonine-protein kinase At1g29720.	No verified direct reference in this release
`At1g53420`	Probable LRR receptor-like serine/threonine-protein kinase At1g53420.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027433 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009861 jasmonic acid and ethylene-dependent systemic resistance Biological Process

GO:0031667 response to nutrient levels Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G07650

ath:AT1G29750

ath:AT1G53420

ath:AT1G53430

ath:AT3G14840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.353

Rank 1 · TkA07G058760 · TK1151

Extracellular0.228

Rank 2 · TkA07G058760 · TK1151

Endoplasmic reticulum0.114

Rank 3 · TkA07G058760 · TK1151

Cytoplasm0.093

Rank 4 · TkA07G058760 · TK1151

Nucleus0.063

Rank 5 · TkA07G058760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855LRR_83-40 aa

PF13516LRR_64-15 aa

PF25013LRR_Zer-14-61 aa

PF12799LRR_45-41 aa

PF00560LRR_16-25 aa

PF23598LRR_1427-106 aa

PF00560LRR_130-50 aa

PF12799LRR_435-68 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G058760	`PF13855`	LRR_8	3	40	3.1e-06	27.6
TkA07G058760	`PF13516`	LRR_6	4	15	0.036	14.8
TkA07G058760	`PF25013`	LRR_Zer-1	4	61	0.05	14.5
TkA07G058760	`PF12799`	LRR_4	5	41	5.5e-12	46.2
TkA07G058760	`PF00560`	LRR_1	6	25	8.1e-23	76.3
TkA07G058760	`PF23598`	LRR_14	27	106	1.6e-07	31.1
TkA07G058760	`PF00560`	LRR_1	30	50	8.1e-23	76.3
TkA07G058760	`PF12799`	LRR_4	35	68	5.5e-12	46.2
TkA07G058760	`PF13516`	LRR_6	36	43	0.036	14.8
TkA07G058760	`PF25013`	LRR_Zer-1	50	85	0.05	14.5
TkA07G058760	`PF12799`	LRR_4	52	86	5.5e-12	46.2
TkA07G058760	`PF13516`	LRR_6	52	66	0.036	14.8
TkA07G058760	`PF13855`	LRR_8	53	112	3.1e-06	27.6
TkA07G058760	`PF00560`	LRR_1	54	75	8.1e-23	76.3
TkA07G058760	`PF13516`	LRR_6	76	90	0.036	14.8
TkA07G058760	`PF00560`	LRR_1	77	99	8.1e-23	76.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FXF2`	Arabidopsis thaliana	sp\|Q9FXF2\|RKF1_ARATH Probable LRR receptor-like serine/threonine-protein kinase RFK1	50.900%	Swiss-Prot	Low
`Q9ASQ6`	Arabidopsis thaliana	sp\|Q9ASQ6\|Y1972_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g29720	37.600%	Swiss-Prot	Medium
`C0LGG7`	Arabidopsis thaliana	sp\|C0LGG7\|Y1534_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53420	29.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card