LXL04_027433 | RubberDandelionOmics

Gene overview

LXL04_027433

Reference: OH-1004 Chr: Chr06 Coordinates: 15764561-15769931 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2993 bp · LXL04_027433|LXL04_027433|OH1004|cDNA

ATGGCGGCAAGGAAACCTCCATCCGTACTGTTTCTAACCTTCAACTTCCTCCTCATCCTACAATTCTCCGAATCCGTTGTTCCGCAACAAGAAGTGGAAGCCGTTGAAAACATTCTTGCTGCCATGAACGCAACAAATTGGAGGTTTAATGGCGACAATTGCATTCTCGACGCCATTTCCGAAGTCCCAAAGCTAACTCAAGAAGCTAATGCTAGCGTCGGATGTGATTGCAACATTGGAAACGATACAAATTGTCATGT...

CDS

Download CDS FASTA

2985 bp · LXL04_027433|LXL04_027433|OH1004|CDS

ATGGCGGCAAGGAAACCTCCATCCGTACTGTTTCTAACCTTCAACTTCCTCCTCATCCTACAATTCTCCGAATCCGTTGTTCCGCAACAAGAAGTGGAAGCCGTTGAAAACATTCTTGCTGCCATGAACGCAACAAATTGGAGGTTTAATGGCGACAATTGCATTCTCGACGCCATTTCCGAAGTCCCAAAGCTAACTCAAGAAGCTAATGCTAGCGTCGGATGTGATTGCAACATTGGAAACGATACAAATTGTCATGT...

Protein

Download Protein FASTA

994 aa · LXL04_027433|LXL04_027433|OH1004|PROTEIN

MAARKPPSVLFLTFNFLLILQFSESVVPQQEVEAVENILAAMNATNWRFNGDNCILDAISEVPKLTQEANASVGCDCNIGNDTNCHVVRMYKALTHKWYSLDGVLSPEMAKLPHLRSFDVAYNLLQGTIPPEWGLTQLHDISLLGNRITGEIPPEIGNITTLTRLDLEANHLSGTIPPDLGKLINLQSLILSSNQFTGRLPVALGQLGNLTNFRINENNFSGPIPDFIQNWKLLSRLELMASGLTGPIPPSISLLENLLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027433`
TK1151 ID	TkA07G058760
OH-1004 ID	LXL04_027433
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 38.531 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027433

Location Chr06:15764561-15769931 (-)

Description Similar to RKF1: Probable LRR receptor-like serine/threonine-protein kinase RFK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g29750`	Probable LRR receptor-like serine/threonine-protein kinase RFK1.	No verified direct reference in this release
`At3g14840`	Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840.	No verified direct reference in this release
`At1g07650`	Probable LRR receptor-like serine/threonine-protein kinase At1g07650.	No verified direct reference in this release
`At1g53430`	Probable LRR receptor-like serine/threonine-protein kinase At1g53430.	No verified direct reference in this release
`At1g53420`	Probable LRR receptor-like serine/threonine-protein kinase At1g53420.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027433 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009861 jasmonic acid and ethylene-dependent systemic resistance Biological Process

GO:0031667 response to nutrient levels Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G07650

ath:AT1G29750

ath:AT1G53420

ath:AT1G53430

ath:AT3G14840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.804

Rank 1 · LXL04_027433 · OH-1004

Endoplasmic reticulum0.090

Rank 2 · LXL04_027433 · OH-1004

Cytoplasm0.077

Rank 3 · LXL04_027433 · OH-1004

Nucleus0.047

Rank 4 · LXL04_027433 · OH-1004

Lysosome / Vacuole0.045

Rank 5 · LXL04_027433 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_14135-214 aa

PF11721.15Malectin410-597 aa

PF00069.32Pkinase676-943 aa

PF07714.24PK_Tyr_Ser-Thr677-945 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027433	`PF23598.2`	LRR_14	135	214	5.8e-07	29.3
LXL04_027433	`PF11721.15`	Malectin	410	597	1.3e-36	126.8
LXL04_027433	`PF00069.32`	Pkinase	676	943	2.3e-45	155.8
LXL04_027433	`PF07714.24`	PK_Tyr_Ser-Thr	677	945	7.4e-51	173.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FXF2`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase RFK1	55.079%	Swiss-Prot	strong database homology
`C0LGN2`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840	49.394%	Swiss-Prot	moderate database homology
`C0LGE0`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g07650	47.421%	Swiss-Prot	moderate database homology
`C0LGG8`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g53430	46.806%	Swiss-Prot	moderate database homology
`C0LGG7`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g53420	47.089%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card