TkA06G395960 | RubberDandelionOmics

Gene overview

TkA06G395960

Reference: TK1151 Chr: Chr06 Coordinates: 98118752-98124656 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3477 bp · TkA06G395960|TK1151|cDNA

TTAAGATTGAAATGGGTTGGTGGGTGGATGGGTGGCTGGTTGATTTGATTACACTCAGAATCTCAGATTCATACATAACCAATTGCCATGTGCGGACAGAATTTCCCGAGAGTACCAGTCAAAGTTAAACTCCATCTGTTCAATCGTTCCTCGGCCCTTCTCCCGCCTCCGACGTCCCCCCGTTGTTACTGTATTTCGACGGAAACCAAGCCGTCTATTTGAGATTCCTAGCCAAGCCGTCTGTTCTACTCTTGGTCTGG...

CDS

Download CDS FASTA

2604 bp · TkA06G395960|TK1151|CDS

ATGAATTTCAGTCCATGCTCAAGTTATTCAAAGATCACATCTTATTGTTCAGAAAATTCACAAAGTATAAACATCAATAAACCAACCTTCACATCTTCAATCAAGGCTAGTGACATCACCACCAACAAAGACAATATCCAGGTGTCTAGTCATGCTGCTAGAAAAGTAGGTGTTTCTTGTGAATATGTGGAAGGAACACGTTTAATTGAGAAACCACAGTCAAAGCCAAGAAAAAAGCTGGAATTTGTGAGGACATTGTT...

Protein

Download Protein FASTA

867 aa · TkA06G395960|TK1151|PROTEIN

MNFSPCSSYSKITSYCSENSQSININKPTFTSSIKASDITTNKDNIQVSSHAARKVGVSCEYVEGTRLIEKPQSKPRKKLEFVRTLLIDNYDSYTYNIYQELSVVNGLPPVVVRNDEWTWEEACYYIYEERAFDNIVISPGPGSPACAADIGICLKLLLECGDIPILGVCLGHQALGYVHGANVVHAFEPVHGRLSEIQHNGSRLFNDIPSGTNSGFKVVRYHSLVIDPKSLPKELIPLAWTCSNDTISSSLVDQKFDQE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G395960`
TK1151 ID	TkA06G395960
OH-1004 ID	LXL04_023126
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G395960

Location Chr06:98118752-98124656 (-)

Description Similar to ADCS: Aminodeoxychorismate synthase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28880`	Bifunctional enzyme that catalyzes the biosynthesis of 4- amino-4-deoxychorismate (ADC) from chorismate and glutamine.	The synthesis of pABA: Coupling between the glutamine amidotransferase and aminodeoxychorismate synthase domains of the bifunctional aminodeoxychorismate synthase from Arabidopsis thaliana.2011 · DOI: 10.1016/j.abb.2010.09.010

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0699700`	Bifunctional enzyme that catalyzes the biosynthesis of 4-amino-4-deoxychorismate (ADC) from chorismate and glutamine.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023126 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000162 L-tryptophan biosynthetic process Biological Process

GO:0008153 4-aminobenzoate biosynthetic process Biological Process

GO:0009396 folic acid-containing compound biosynthetic process Biological Process

GO:0017000 antibiotic biosynthetic process Biological Process

GO:0046417 chorismate metabolic process Biological Process

GO:0046654 tetrahydrofolate biosynthetic process Biological Process

GO:0046656 folic acid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0046820 4-amino-4-deoxychorismate synthase activity Molecular Function

KEGG gene cross-reference

ath:AT2G28880

dosa:Os06g0699700

sly:543912

sve:SVEN_0920

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.854

Rank 1 · TkA06G395960 · TK1151

Mitochondrion0.172

Rank 2 · TkA06G395960 · TK1151

Cytoplasm0.098

Rank 3 · TkA06G395960 · TK1151

Peroxisome0.044

Rank 4 · TkA06G395960 · TK1151

Nucleus0.041

Rank 5 · TkA06G395960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00117GATase86-248 aa

PF07722Peptidase_C26163-297 aa

PF00117GATase276-311 aa

PF00425Chorismate_bind483-855 aa

PF30495Chorismate_bind_2516-853 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G395960	`PF00117`	GATase	86	248	5.2e-40	137.9
TkA06G395960	`PF07722`	Peptidase_C26	163	297	0.0071	16.9
TkA06G395960	`PF00117`	GATase	276	311	5.2e-40	137.9
TkA06G395960	`PF00425`	Chorismate_bind	483	855	3.6e-118	396.2
TkA06G395960	`PF30495`	Chorismate_bind_2	516	853	4.2e-42	145.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LPN3`	Arabidopsis thaliana	sp\|Q8LPN3\|ADCS_ARATH Aminodeoxychorismate synthase, chloroplastic	58.800%	Swiss-Prot	High
`Q5Z856`	Oryza sativa subsp. japonica	sp\|Q5Z856\|ADCS_ORYSJ Probable aminodeoxychorismate synthase, chloroplastic	58.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card