TkA06G168690 | RubberDandelionOmics

Gene overview

TkA06G168690

Reference: TK1151 Chr: Chr06 Coordinates: 44355994-44358228 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1273 bp · TkA06G168690|TK1151|cDNA

AACTGACATCACATTTTACAATAGCAGCTCGTGGACTACGTTGACGAAGACGAAGCGACTTGCATCGAGCGTACTAGGTTGAGTAAATCAAAGGCGAGGTGCAAGTTTAGAATCAGATTCCATAATAGGAAGACAGAAATTGAACGAAAAGGAACAATCTTATTAAGATGAAGAGTACAGCGTCCAAAAGAGAAGAGCACCTTAAAATCACCAATGGCGGCATTAACTCAAGCACAATTACAACTTCCGACATGAACAAT...

CDS

Download CDS FASTA

588 bp · TkA06G168690|TK1151|CDS

ATGAAGAGTACAGCGTCCAAAAGAGAAGAGCACCTTAAAATCACCAATGGCGGCATTAACTCAAGCACAATTACAACTTCCGACATGAACAATTTGGTGCCAAAATCAAAAACATACTCCGATATTATCAAGGGTAAGATGATCTCAAAAGAAGAGGAATACACAAAAATCACAAATGGTGATACTGCAAGCTATGAATTAACACGAAAGAGACAAAGGCAAAAAGCAAAACACAAAAAAAGTAATCTTTTTGAAAAACT...

Protein

Download Protein FASTA

195 aa · TkA06G168690|TK1151|PROTEIN

MKSTASKREEHLKITNGGINSSTITTSDMNNLVPKSKTYSDIIKGKMISKEEEYTKITNGDTASYELTRKRQRQKAKHKKSNLFEKLTIGSMEILIDYSYNNGVQIMRTHVARSRKKLLILDVNGLLADIILPPPKDCKSDKIILKRAIFKRPFLDDFLRFCFQRFDVAIWSSRTRTRLIARIRVLGVLKTGINS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G168690`
TK1151 ID	TkA06G168690
OH-1004 ID	LXL04_024180
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.800
Protein coverage (%)	TK1151 97.436 / OH-1004 58.410 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G168690`
Location	Chr06:44355994-44358228 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_024180` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0023052 signaling Biological Process GO:0090364 regulation of proteasome assembly Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0005829 cytosol Cellular Component GO:0004721 phosphoprotein phosphatase activity Molecular Function GO:0004722 protein serine/threonine phosphatase activity Molecular Function GO:0046872 metal ion binding Molecular Function GO:1904855 proteasome regulatory particle binding Molecular Function
KEGG gene cross-reference	gga:416237 spo:2541320 xla:447721 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.538

Rank 1 · TkA06G168690 · TK1151

Cytoplasm0.332

Rank 2 · TkA06G168690 · TK1151

Cell membrane0.156

Rank 3 · TkA06G168690 · TK1151

Endoplasmic reticulum0.079

Rank 4 · TkA06G168690 · TK1151

Golgi apparatus0.030

Rank 5 · TkA06G168690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03031NIF117-177 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G168690	`PF03031`	NIF	117	177	2.5e-06	28.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card