TkA06G145880 | RubberDandelionOmics

Gene overview

TkA06G145880

Reference: TK1151 Chr: Chr06 Coordinates: 38233102-38236819 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2426 bp · TkA06G145880|TK1151|cDNA

AAAAAAAAAAAAAACACTCCACACTCCACACCTTTCTTACTTCATTCCACCTTGTTATTAGTTTCAAAAATGGAGGGAACGCAAAGCATGATAATTAGTTTTCAATCTCTTCAATGATTCAGTGAGCTTTAACGATCCCTTTTTCTTTATTCCAAGTGTGAAAGTGAGTTCGATAAGTAGAAAAAAAAACATCAAGTCTATGATGAACACCAACGAAAACAACAACAATGACGACGAAAAAAACAGTCAAAACAACAACT...

CDS

Download CDS FASTA

1119 bp · TkA06G145880|TK1151|CDS

ATGATGAACACCAACGAAAACAACAACAATGACGACGAAAAAAACAGTCAAAACAACAACTGGTTGGGTTTCTCTCTTTCACCTCATATGAACACCACCACCACAACAACCACAACCACCGCCACGTCATCAATGGAGGGTAGTAATGCGACTCATCACCCCTGTTCTTCGTCTTCCAACCCCACAACTTATTTCAATCTCCCTTCCCATTTCAACTACCCAAACATCTACTGCCATGGCGTCGACGGTGAAAACGGAAG...

Protein

Download Protein FASTA

372 aa · TkA06G145880|TK1151|PROTEIN

MMNTNENNNNDDEKNSQNNNWLGFSLSPHMNTTTTTTTTTATSSMEGSNATHHPCSSSSNPTTYFNLPSHFNYPNIYCHGVDGENGSGLYSGFPIMPLKSDGSLCLMEAITRSQSHSQGMVVSSNPPKLENFFGGVTMGTPDFDRGEGGGATMALGLDSSTTMYYNQNPEHETLQHNHRHHQHQIQPQPFPDYSGFRALYQTVQQEEEVKHDQNIVADTCNLHLPSIGEDDDVTGMKNWISRNYHSGVTTADHGGGGGGY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G145880`
TK1151 ID	TkA06G145880
OH-1004 ID	LXL04_024420
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 98.118 / OH-1004 56.327 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G145880

Location Chr06:38233102-38236819 (-)

Description Similar to ANT: AP2-like ethylene-responsive transcription factor ANT

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37750`	Transcription activator that recognizes and binds to the DNA consensus sequence 5'-CAC[AG]N[AT]TNCCNANG-3'.	No verified direct reference in this release
`At1g72570`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g51190`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At3g20840`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0124700`	Acts as a positive regulator of adventitious (crown) root formation by promoting its initiation.	The auxin responsive AP2/ERF transcription factor CROWN ROOTLESS5 is involved in crown root initiation in rice through the induction of OsRR1, a type-A response regulator of cytokinin signaling.2011 · DOI: 10.1111/j.1365-313x.2011.04610.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024420 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007276 gamete generation Biological Process

GO:0007389 pattern specification process Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010449 root meristem growth Biological Process

GO:0010492 maintenance of shoot apical meristem identity Biological Process

KEGG gene cross-reference

ath:AT1G51190

ath:AT1G72570

ath:AT4G37750

dosa:Os07g0124700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.977

Rank 1 · TkA06G145880 · TK1151

Cytoplasm0.077

Rank 2 · TkA06G145880 · TK1151

Cell membrane0.030

Rank 3 · TkA06G145880 · TK1151

Endoplasmic reticulum0.024

Rank 4 · TkA06G145880 · TK1151

Plastid0.013

Rank 5 · TkA06G145880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13190PDGLE154-194 aa

PF13271DUF4062269-341 aa

PF00847AP2332-356 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G145880	`PF13190`	PDGLE	154	194	0.27	11.8
TkA06G145880	`PF13271`	DUF4062	269	341	0.082	13.7
TkA06G145880	`PF00847`	AP2	332	356	0.012	16.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38914`	Arabidopsis thaliana	sp\|Q38914\|ANT_ARATH AP2-like ethylene-responsive transcription factor ANT	39.400%	Swiss-Prot	Medium
`Q1PFE1`	Arabidopsis thaliana	sp\|Q1PFE1\|AIL1_ARATH AP2-like ethylene-responsive transcription factor AIL1	56.300%	Swiss-Prot	Low
`Q5YGP7`	Arabidopsis thaliana	sp\|Q5YGP7\|PLET2_ARATH AP2-like ethylene-responsive transcription factor PLT2	54.200%	Swiss-Prot	Low
`Q5YGP8`	Arabidopsis thaliana	sp\|Q5YGP8\|PLET1_ARATH AP2-like ethylene-responsive transcription factor PLT1	85.700%	Swiss-Prot	Low
`Q84Z02`	Oryza sativa subsp. japonica	sp\|Q84Z02\|CRL5_ORYSJ AP2-like ethylene-responsive transcription factor CRL5	36.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card