TkA06G141990 | RubberDandelionOmics

Gene overview

TkA06G141990

Reference: TK1151 Chr: Chr06 Coordinates: 37232969-37234042 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

597 bp · TkA06G141990|TK1151|cDNA

TCAGATTTTCTTAATCTGTTTGATTTGGAAGTCCTCCTCTTGAACAATAATGGTTTTACTGGAGCAATACCAACGGAAGCATACCTATCTAATCCTCTCTTGTGTCATTTAAATGCGGAGATATCAGAGTTCAATGAATCAAGAGAAAAGGAGTTGCCTTTAATTCAAGAAGTTGACATCAAAATCAAAGAACTTCGCCAGATGATTTCAGCCCTTAATAATCAACAAATGTCACTAAAGGCTGCATTTAGAAAAAAGAA...

CDS

Download CDS FASTA

597 bp · TkA06G141990|TK1151|CDS

TCAGATTTTCTTAATCTGTTTGATTTGGAAGTCCTCCTCTTGAACAATAATGGTTTTACTGGAGCAATACCAACGGAAGCATACCTATCTAATCCTCTCTTGTGTCATTTAAATGCGGAGATATCAGAGTTCAATGAATCAAGAGAAAAGGAGTTGCCTTTAATTCAAGAAGTTGACATCAAAATCAAAGAACTTCGCCAGATGATTTCAGCCCTTAATAATCAACAAATGTCACTAAAGGCTGCATTTAGAAAAAAGAA...

Protein

Download Protein FASTA

198 aa · TkA06G141990|TK1151|PROTEIN

SDFLNLFDLEVLLLNNNGFTGAIPTEAYLSNPLLCHLNAEISEFNESREKELPLIQEVDIKIKELRQMISALNNQQMSLKAAFRKKKEAVKEMDEKISSAEFALVQSAQENASLHSKIVQSPVKLQRALEEKKAVLIESKNAERESMQSFQIIYFVISRAYRLTDKQVHRVLFMGFLKMDRRLEQLVEMEKVHIRMRY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G141990`
TK1151 ID	TkA06G141990
OH-1004 ID	LXL04_025902
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.000
Protein coverage (%)	TK1151 99.495 / OH-1004 64.078 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G141990

Location Chr06:37232969-37234042 (+)

Description Similar to NUF2: Kinetochore protein NUF2 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61000`	Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity to ensure proper cell division.	MUN (MERISTEM UNSTRUCTURED), encoding a SPC24 homolog of NDC80 kinetochore complex, affects development through cell division in Arabidopsis thaliana.2018 · DOI: 10.1111/tpj.13823

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025902 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0007052 mitotic spindle organization Biological Process

GO:0008361 regulation of cell size Biological Process

GO:0009624 response to nematode Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0009877 nodulation Biological Process

GO:0010091 trichome branching Biological Process

GO:0010342 endosperm cellularization Biological Process

GO:0010492 maintenance of shoot apical meristem identity Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031145 anaphase-promoting complex-dependent catabolic process Biological Process

KEGG gene cross-reference

ath:AT1G61000

ath:AT4G11920

ath:AT4G22910

ath:AT5G13840

mtr:25493638

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.525

Rank 1 · TkA06G141990 · TK1151

Nucleus0.374

Rank 2 · TkA06G141990 · TK1151

Cell membrane0.084

Rank 3 · TkA06G141990 · TK1151

Mitochondrion0.071

Rank 4 · TkA06G141990 · TK1151

Golgi apparatus0.063

Rank 5 · TkA06G141990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29997SPC25_N36-97 aa

PF28016Mua40-167 aa

PF10198Ada340-110 aa

PF19456MobI42-79 aa

PF07517SecA_DEAD44-111 aa

PF10186ATG1455-129 aa

PF02609Exonuc_VII_S61-92 aa

PF09989DUF222961-171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G141990	`PF29997`	SPC25_N	36	97	0.88	10.6
TkA06G141990	`PF28016`	Mua	40	167	0.033	15.1
TkA06G141990	`PF10198`	Ada3	40	110	0.18	12.6
TkA06G141990	`PF19456`	MobI	42	79	0.068	14.0
TkA06G141990	`PF07517`	SecA_DEAD	44	111	6.0	6.8
TkA06G141990	`PF10186`	ATG14	55	129	0.086	12.6
TkA06G141990	`PF02609`	Exonuc_VII_S	61	92	0.085	13.6
TkA06G141990	`PF09989`	DUF2229	61	171	0.58	10.5
TkA06G141990	`PF13720`	Acetyltransf_11	61	95	2.7	9.2
TkA06G141990	`PF15882`	DUF4735	62	143	0.17	12.1
TkA06G141990	`PF00709`	Adenylsucc_synt	73	142	0.18	11.2
TkA06G141990	`PF29997`	SPC25_N	110	147	0.88	10.6
TkA06G141990	`PF13720`	Acetyltransf_11	116	138	2.7	9.2
TkA06G141990	`PF07517`	SecA_DEAD	127	179	6.0	6.8
TkA06G141990	`PF19456`	MobI	145	159	0.068	14.0
TkA06G141990	`PF13720`	Acetyltransf_11	166	189	2.7	9.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXJ0`	Arabidopsis thaliana	sp\|Q8RXJ0\|NUF2_ARATH Kinetochore protein NUF2 homolog	55.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card