TkA05G335440 | RubberDandelionOmics

Gene overview

TkA05G335440

Reference: TK1151 Chr: Chr05 Coordinates: 82873671-82876238 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1014 bp · TkA05G335440|TK1151|cDNA

CAGTCCTCAAAGAATTTACTTTCTCCTGCATTTGTAGTATTGTGGTTTGAGCATCCACCAGACCAAATCAGAGAAGATGATGCCCACGTCATCACCTCTTTGACTAGTCAAGGCATCAATGTCTTCCTTCTTTCTGGTGATAAAAAAAGCTCAGCTCATTATGTTGCTTCTGTAGTCGGTATTCCAAAAGACCAGGTGATGTATGGAGTTAAACCAGATGAGAAAAGTAAGTTCATAAGCGGACTGAAGAAGGACAACCG...

CDS

Download CDS FASTA

1014 bp · TkA05G335440|TK1151|CDS

CAGTCCTCAAAGAATTTACTTTCTCCTGCATTTGTAGTATTGTGGTTTGAGCATCCACCAGACCAAATCAGAGAAGATGATGCCCACGTCATCACCTCTTTGACTAGTCAAGGCATCAATGTCTTCCTTCTTTCTGGTGATAAAAAAAGCTCAGCTCATTATGTTGCTTCTGTAGTCGGTATTCCAAAAGACCAGGTGATGTATGGAGTTAAACCAGATGAGAAAAGTAAGTTCATAAGCGGACTGAAGAAGGACAACCG...

Protein

Download Protein FASTA

337 aa · TkA05G335440|TK1151|PROTEIN

QSSKNLLSPAFVVLWFEHPPDQIREDDAHVITSLTSQGINVFLLSGDKKSSAHYVASVVGIPKDQVMYGVKPDEKSKFISGLKKDNRNLVSMVGDGINDAAALAESHVGVAIGGEVGAASEVASIVLMGNKISQLIDALELSRQTMKTVKQNLLKDIELSKEINESFKQSSQARTKLPSGIELSVHVLTTGYWPTYPPMDVRLPHELNVYQEIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKELVVSLFQTVVLM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G335440`
TK1151 ID	TkA05G335440
OH-1004 ID	LXL04_027523
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.400
Protein coverage (%)	TK1151 49.852 / OH-1004 20.217 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G335440

Location Chr05:82873671-82876238 (-)

Description Similar to CUL4: Cullin-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46210`	Component of the CUL4-RBX1-CDD (COP10-DDB1a-DET1) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	CUL4 associates with DDB1 and DET1 and its downregulation affects diverse aspects of development in Arabidopsis thaliana.2006 · DOI: 10.1111/j.1365-313x.2006.02810.x Arabidopsis CULLIN4 Forms an E3 Ubiquitin Ligase with RBX1 and the CDD Complex in Mediating Light Control of Development.2006 · DOI: 10.1105/tpc.106.043224 Characterization of Arabidopsis and rice DWD proteins and their roles as substrate receptors for CUL4-RING E3 ubiquitin ligases.2008 · DOI: 10.1105/tpc.107.055418 Arabidopsis DDB1-CUL4 ASSOCIATED FACTOR1 forms a nuclear E3 ubiquitin ligase with DDB1 and CUL4 that is involved in multiple plant developmental processes.2008 · DOI: 10.1105/tpc.108.058891 Arabidopsis CULLIN4-damaged DNA binding protein 1 interacts with CONSTITUTIVELY PHOTOMORPHOGENIC1-SUPPRESSOR OF PHYA complexes to regulate photomorphogenesis and flowering time.2010 · DOI: 10.1105/tpc.109.065490 DWA1 and DWA2, two Arabidopsis DWD protein components of CUL4-based E3 ligases, act together as negative regulators in ABA signal transduction.2010 · DOI: 10.1105/tpc.109.073783

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027523 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000082 G1/S transition of mitotic cell cycle Biological Process

GO:0000209 protein polyubiquitination Biological Process

GO:0006281 DNA repair Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0008283 cell population proliferation Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT5G46210

hsa:8450

hsa:8451

mmu:72584

mmu:99375

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.487

Rank 1 · TkA05G335440 · TK1151

Nucleus0.313

Rank 2 · TkA05G335440 · TK1151

Mitochondrion0.114

Rank 3 · TkA05G335440 · TK1151

Endoplasmic reticulum0.102

Rank 4 · TkA05G335440 · TK1151

Cell membrane0.078

Rank 5 · TkA05G335440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00702Hydrolase20-105 aa

PF08282Hydrolase_322-61 aa

PF08282Hydrolase_390-128 aa

PF18306LDcluster4103-149 aa

PF19757DUF6244107-151 aa

PF26557Cullin_AB187-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G335440	`PF00702`	Hydrolase	20	105	3.4e-09	38.1
TkA05G335440	`PF08282`	Hydrolase_3	22	61	0.025	15.1
TkA05G335440	`PF08282`	Hydrolase_3	90	128	0.025	15.1
TkA05G335440	`PF18306`	LDcluster4	103	149	0.099	13.0
TkA05G335440	`PF19757`	DUF6244	107	151	0.33	12.2
TkA05G335440	`PF26557`	Cullin_AB	187	318	5.2e-47	160.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LGH4`	Arabidopsis thaliana	sp\|Q8LGH4\|CUL4_ARATH Cullin-4	87.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card