TkA05G076020 | RubberDandelionOmics

Gene overview

TkA05G076020

Reference: TK1151 Chr: Chr05 Coordinates: 20232860-20237274 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2995 bp · TkA05G076020|TK1151|cDNA

AACTCATATCATCCGTTTTACTAAATTACCCTCCGTTTTCCTCATTTCTCTCATCATCGGCGTAATTCAAGAACTCAAGGGACCTCTTGATTCCCTTGATTCTCCGAAGGTTTCTTATTTTCAACGATCCTTCCGCCCACAATTCTTCGATTCAACATCCTCGAATCTTCAAGTTTCAAGAAATCTTGATTTCCTAAGACCTGGAGGTTCACATATGAGTGGCAATGGCCGACCAGCCTAACTTTCCCGCCGGATACCCA...

CDS

Download CDS FASTA

2598 bp · TkA05G076020|TK1151|CDS

ATGGCCGACCAGCCTAACTTTCCCGCCGGATACCCAGTCGGAATCAGCCCCTCCACCCCCGAGCCACCACCATCCCGGAGACCCAACCCCAAATCAAGTCCACCACCTTTTACACCGCCACAAGGTCCAATCTTTTCACCACCAACCATCCAACCACCAAACCAGATCCTCTCCTCTTCCATCAAATCCTCAAATGGAATCAGAACAACCGGAAACCCCCCTCCACATCTGAGCACCCCGCCAGGACCGCCAGTCTTTTC...

Protein

Download Protein FASTA

865 aa · TkA05G076020|TK1151|PROTEIN

MADQPNFPAGYPVGISPSTPEPPPSRRPNPKSSPPPFTPPQGPIFSPPTIQPPNQILSSSIKSSNGIRTTGNPPPHLSTPPGPPVFSSPVQPAAVPFRTSPASPQPVAFSSISSLSASPPSGYSDGNNEFQRQVSSDGDDTVALSDPPNVLLSARKILKQKKLMNVPSLGFGALVSPGREALHSPQIIQRDPHRCQNCGAYANLYCNILLGSGQWQCVICRNLNGSEGEYIASTKDQLLNLPELAFPVIDFIQTANRRPG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G076020`
TK1151 ID	TkA05G076020
OH-1004 ID	LXL04_019694
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 99.191 / OH-1004 99.421 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G076020

Location Chr05:20232860-20237274 (+)

Description Similar to SEC231: Protein transport protein SEC23-1 (Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g01810`	Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER) (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019694 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0048658 anther wall tapetum development Biological Process

GO:0090110 COPII-coated vesicle cargo loading Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0030127 COPII vesicle coat Cellular Component

GO:0070971 endoplasmic reticulum exit site Cellular Component

GO:0005096 GTPase activator activity Molecular Function

KEGG gene cross-reference

ago:AGOS_AEL272W

ath:AT4G01810

cgr:2888139

pgu:PGUG_00105

xtr:780116

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.593

Rank 1 · TkA05G076020 · TK1151

Nucleus0.252

Rank 2 · TkA05G076020 · TK1151

Golgi apparatus0.157

Rank 3 · TkA05G076020 · TK1151

Endoplasmic reticulum0.115

Rank 4 · TkA05G076020 · TK1151

Lysosome / Vacuole0.106

Rank 5 · TkA05G076020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04810zf-Sec23_Sec24192-230 aa

PF13519VWA_2274-317 aa

PF04811Sec23_trunk275-494 aa

PF29444KH_FAR1_2nd282-313 aa

PF13519VWA_2381-418 aa

PF08033Sec23_BS511-602 aa

PF04815Sec23_helical617-710 aa

PF00626Gelsolin742-803 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G076020	`PF04810`	zf-Sec23_Sec24	192	230	4.7e-11	43.2
TkA05G076020	`PF13519`	VWA_2	274	317	0.14	13.5
TkA05G076020	`PF04811`	Sec23_trunk	275	494	1.7e-14	54.7
TkA05G076020	`PF29444`	KH_FAR1_2nd	282	313	0.23	12.0
TkA05G076020	`PF13519`	VWA_2	381	418	0.14	13.5
TkA05G076020	`PF08033`	Sec23_BS	511	602	2.3e-13	51.2
TkA05G076020	`PF04815`	Sec23_helical	617	710	2.7e-08	34.2
TkA05G076020	`PF00626`	Gelsolin	742	803	0.0017	18.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84WV4`	Arabidopsis thaliana	sp\|Q84WV4\|SC23A_ARATH Protein transport protein SEC23 A	68.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card