LXL04_019694 | RubberDandelionOmics

Gene overview

LXL04_019694

Reference: OH-1004 Chr: Chr04 Coordinates: 37064877-37067983 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2592 bp · LXL04_019694|LXL04_019694|OH1004|cDNA

ATGGCCGACCAGCCTAACTTTCCCGCCGGATACCCAGTCGGAATCAGCCCCTCCACCCCCGAGCCACCACCATCCCGGAGACCCAACCCCAAATCAAGTCCACCACCTTTTACACCGCCACAAGGTCCAATCTTTTCACCACCAACCATACAACCCCCAAATCAAATCCTCTCCCCTTCCATCAAATCCTCAAATGGAATCAGAACAACCGGAAACCCCCCTCCACATCTGAGCACCCCGCCAGGACCGCCAGTCTTTTC...

CDS

Download CDS FASTA

2592 bp · LXL04_019694|LXL04_019694|OH1004|CDS

ATGGCCGACCAGCCTAACTTTCCCGCCGGATACCCAGTCGGAATCAGCCCCTCCACCCCCGAGCCACCACCATCCCGGAGACCCAACCCCAAATCAAGTCCACCACCTTTTACACCGCCACAAGGTCCAATCTTTTCACCACCAACCATACAACCCCCAAATCAAATCCTCTCCCCTTCCATCAAATCCTCAAATGGAATCAGAACAACCGGAAACCCCCCTCCACATCTGAGCACCCCGCCAGGACCGCCAGTCTTTTC...

Protein

Download Protein FASTA

863 aa · LXL04_019694|LXL04_019694|OH1004|PROTEIN

MADQPNFPAGYPVGISPSTPEPPPSRRPNPKSSPPPFTPPQGPIFSPPTIQPPNQILSPSIKSSNGIRTTGNPPPHLSTPPGPPVFSSPVQPAAVPFRTSPATPQPVAFSSISSLSASPPSGYSDGNNEFQRQVSSDGDDTVALSDPPNVLLSARKILKQKKLMNVPSLGFGALVSPGREALHSPQIIQRDPHRCQNCGAYANLYCNILLGSGQWQCVICRNLNGSEGEYIASTKDQLLNLPELAFPVIDFIQTANRRPG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019694`
TK1151 ID	TkA05G076020
OH-1004 ID	LXL04_019694
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 99.191 / OH-1004 99.421 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019694

Location Chr04:37064877-37067983 (+)

Description Similar to SEC231: Protein transport protein SEC23-1 (Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g01810`	Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER) (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019694 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0048658 anther wall tapetum development Biological Process

GO:0090110 COPII-coated vesicle cargo loading Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0030127 COPII vesicle coat Cellular Component

GO:0070971 endoplasmic reticulum exit site Cellular Component

GO:0005096 GTPase activator activity Molecular Function

KEGG gene cross-reference

ago:AGOS_AEL272W

ath:AT4G01810

cgr:2888139

pgu:PGUG_00105

xtr:780116

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.607

Rank 1 · LXL04_019694 · OH-1004

Nucleus0.249

Rank 2 · LXL04_019694 · OH-1004

Golgi apparatus0.157

Rank 3 · LXL04_019694 · OH-1004

Endoplasmic reticulum0.116

Rank 4 · LXL04_019694 · OH-1004

Lysosome / Vacuole0.110

Rank 5 · LXL04_019694 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04810.21zf-Sec23_Sec24192-230 aa

PF04811.22Sec23_trunk275-494 aa

PF08033.18Sec23_BS511-602 aa

PF04815.21Sec23_helical617-710 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019694	`PF04810.21`	zf-Sec23_Sec24	192	230	4.5e-11	43.3
LXL04_019694	`PF04811.22`	Sec23_trunk	275	494	4.7e-15	56.6
LXL04_019694	`PF08033.18`	Sec23_BS	511	602	3.5e-13	50.7
LXL04_019694	`PF04815.21`	Sec23_helical	617	710	5.8e-09	36.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84WV4`	Arabidopsis thaliana	Protein transport protein SEC23 A	68.481%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card