TkA05G063080 | RubberDandelionOmics

Gene overview

TkA05G063080

Reference: TK1151 Chr: Chr05 Coordinates: 16795800-16799797 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2431 bp · TkA05G063080|TK1151|cDNA

CGACTGTATCATCCCGCCGTCAAATTCATATTATTACATCTTAAGTTATCCATGAATGTTTAGCCATTTTTTGGGTTTTGGAGTTTCTGCAGGGCGGATAGGGATTTGATGGATAGATTGAGGTAGTAATGTGTAATATTATTGTGGATAGAGGAAGTCACCGGGAGATGGGTGAGTAGTAAGCTGGTCAGCACTCAGCACCCATCTTCCATCACCTCCTCCGATCCTTCTTGGCAACAACTCGGAAGGTTTCCTGCTGC...

CDS

Download CDS FASTA

1686 bp · TkA05G063080|TK1151|CDS

ATGGGCAATACATGCCGTGGATCTTTAGGAACAAAACACACACAGGGTTTAAATAAGCCCGAAGACCATTCAATCGCTTCTCAAAATCCTTCATCAGCTTTATCCAACAACTCTCTAGATTACTCGCCGACCACCTTAATCTCCAACCAACTCATCGCGCAAGAATTCTCAAAAGAACCCACTCCCAAACCCCTCCCTCTTCCCAAAAAAGACGCCACCATGAGCCGCCACGGAACCTCCAACCAATCCTACTACGTTCT...

Protein

Download Protein FASTA

561 aa · TkA05G063080|TK1151|PROTEIN

MGNTCRGSLGTKHTQGLNKPEDHSIASQNPSSALSNNSLDYSPTTLISNQLIAQEFSKEPTPKPLPLPKKDATMSRHGTSNQSYYVLGHKTDNIRDVYTLGQKLGQGQFGTTYLCTEIATGIDYACKSISKRKLISKEDLEDVRREIQIMHHLAGHNNIVTIKGAYEDPLYVHIVMELCNGGELFDRIIQRGHYSERKAAELTKIIVGVVEACHSLGVMHRDLKPENFLLVNRDDDFSLKAIDFGLSVFFKPGQIFTDVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G063080`
TK1151 ID	TkA05G063080
OH-1004 ID	LXL04_019562
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G063080

Location Chr05:16795800-16799797 (-)

Description Similar to CPK4: Calcium-dependent protein kinase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17290`	May play a role in signal transduction pathways that involve calcium as a second messenger.	CDPKs CPK6 and CPK3 function in ABA regulation of guard cell S-type anion- and Ca(2+)-permeable channels and stomatal closure.2006 · DOI: 10.1371/journal.pbio.0040327 Calcium-dependent protein kinases responsible for the phosphorylation of a bZIP transcription factor FD crucial for the florigen complex formation.2015 · DOI: 10.1038/srep08341
`At4g35310`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0584600`	May play a role in signal transduction pathways that involve calcium as a second messenger (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019562 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:1901002 positive regulation of response to salt stress Biological Process

GO:1902456 regulation of stomatal opening Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT2G17290

ath:AT4G35310

dosa:Os04g0584600

osa:4336783

sot:102594309

sot:102604043

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.429

Rank 1 · TkA05G063080 · TK1151

Cell membrane0.428

Rank 2 · TkA05G063080 · TK1151

Nucleus0.228

Rank 3 · TkA05G063080 · TK1151

Golgi apparatus0.093

Rank 4 · TkA05G063080 · TK1151

Endoplasmic reticulum0.059

Rank 5 · TkA05G063080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14531Kinase-like97-155 aa

PF00069Pkinase98-356 aa

PF07714PK_Tyr_Ser-Thr99-350 aa

PF13499EF-hand_7133-147 aa

PF13202EF-hand_5135-142 aa

PF01636APH135-157 aa

PF06293Kdo174-244 aa

PF03109ABC1174-251 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G063080	`PF14531`	Kinase-like	97	155	0.027	14.5
TkA05G063080	`PF00069`	Pkinase	98	356	6.1e-76	256.0
TkA05G063080	`PF07714`	PK_Tyr_Ser-Thr	99	350	5.5e-23	82.3
TkA05G063080	`PF13499`	EF-hand_7	133	147	1.1e-28	100.0
TkA05G063080	`PF13202`	EF-hand_5	135	142	4.1e-23	80.4
TkA05G063080	`PF01636`	APH	135	157	0.11	13.0
TkA05G063080	`PF06293`	Kdo	174	244	0.00011	22.5
TkA05G063080	`PF03109`	ABC1	174	251	0.0083	16.0
TkA05G063080	`PF14531`	Kinase-like	193	244	0.027	14.5
TkA05G063080	`PF24548`	EF_EFCAB10_C	211	226	1.7e-05	25.1
TkA05G063080	`PF01636`	APH	216	246	0.11	13.0
TkA05G063080	`PF13833`	EF-hand_8	307	318	9.9e-18	64.4
TkA05G063080	`PF20742`	DUF5580_M	384	462	3.4e-06	27.7
TkA05G063080	`PF04028`	DUF374	384	422	0.083	13.2
TkA05G063080	`PF13833`	EF-hand_8	386	425	9.9e-18	64.4
TkA05G063080	`PF12763`	EH	396	464	1.6e-08	35.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38872`	Arabidopsis thaliana	sp\|Q38872\|CDPK6_ARATH Calcium-dependent protein kinase 6	83.600%	Swiss-Prot	High
`Q38871`	Arabidopsis thaliana	sp\|Q38871\|CDPK5_ARATH Calcium-dependent protein kinase 5	78.900%	Swiss-Prot	High
`Q9FXQ3`	Oryza sativa subsp. japonica	sp\|Q9FXQ3\|CDPKD_ORYSJ Calcium-dependent protein kinase 13	79.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card