TkA05G062300 | RubberDandelionOmics

Gene overview

TkA05G062300

Reference: TK1151 Chr: Chr05 Coordinates: 16568269-16570027 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

474 bp · TkA05G062300|TK1151|cDNA

ATGGTCGACCGACGTACCAAGAGATGGGGGTTAGTGCATACTCATCATTTGCAAGAATTGGAGGTGGACTTTATGAGCAACAAAAGAGGAGAGTTGACTCTTCAACAAATCTGTGGTGATTTTAATTCGGTTCCTGGAAGGGTTACAGATGTTGGCATATCACATCTGGTAAAGAACTGCAAGCATATTGTTGAGTTGAACTTAAGTGGCTGTAAGTGTCTAGAGTTGCTAGATATCACTAGGTGCATTAAGATAACAGA...

CDS

Download CDS FASTA

474 bp · TkA05G062300|TK1151|CDS

ATGGTCGACCGACGTACCAAGAGATGGGGGTTAGTGCATACTCATCATTTGCAAGAATTGGAGGTGGACTTTATGAGCAACAAAAGAGGAGAGTTGACTCTTCAACAAATCTGTGGTGATTTTAATTCGGTTCCTGGAAGGGTTACAGATGTTGGCATATCACATCTGGTAAAGAACTGCAAGCATATTGTTGAGTTGAACTTAAGTGGCTGTAAGTGTCTAGAGTTGCTAGATATCACTAGGTGCATTAAGATAACAGA...

Protein

Download Protein FASTA

157 aa · TkA05G062300|TK1151|PROTEIN

MVDRRTKRWGLVHTHHLQELEVDFMSNKRGELTLQQICGDFNSVPGRVTDVGISHLVKNCKHIVELNLSGCKCLELLDITRCIKITDGSLQHIITKCSGLKSLNLYALSSFTDEAYKKLSLLGNLRFLDLCGAQNLSDEGLLSIAKCKNIRTLSLTW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G062300`
TK1151 ID	TkA05G062300
OH-1004 ID	LXL04_000289
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.400
Protein coverage (%)	TK1151 96.178 / OH-1004 65.368 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G062300

Location Chr05:16568269-16570027 (+)

Description Similar to At3g58530: F-box protein At3g58530

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g58530`	F-box protein At3g58530.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000289 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0010311 lateral root formation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0051781 positive regulation of cell division Biological Process

GO:0071365 cellular response to auxin stimulus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

KEGG gene cross-reference

ath:AT1G21410

ath:AT3G58530

bta:531211

hsa:144699

mmu:101358

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.542

Rank 1 · TkA05G062300 · TK1151

Cytoplasm0.299

Rank 2 · TkA05G062300 · TK1151

Mitochondrion0.122

Rank 3 · TkA05G062300 · TK1151

Cell membrane0.036

Rank 4 · TkA05G062300 · TK1151

Endoplasmic reticulum0.020

Rank 5 · TkA05G062300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12799LRR_415-22 aa

PF13516LRR_615-22 aa

PF25372LRR_FBXL1538-105 aa

PF25372LRR_FBXL1542-70 aa

PF13516LRR_648-54 aa

PF23952LRR_EndoS48-80 aa

PF23286LRR_1351-94 aa

PF29594LRR_SKP252-72 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G062300	`PF12799`	LRR_4	15	22	1.6e-05	25.7
TkA05G062300	`PF13516`	LRR_6	15	22	0.029	15.1
TkA05G062300	`PF25372`	LRR_FBXL15	38	105	4.2e-08	32.7
TkA05G062300	`PF25372`	LRR_FBXL15	42	70	4.2e-08	32.7
TkA05G062300	`PF13516`	LRR_6	48	54	0.029	15.1
TkA05G062300	`PF23952`	LRR_EndoS	48	80	0.17	12.9
TkA05G062300	`PF23286`	LRR_13	51	94	1.2	9.5
TkA05G062300	`PF29594`	LRR_SKP2	52	72	4.9e-08	33.3
TkA05G062300	`PF12799`	LRR_4	52	77	1.6e-05	25.7
TkA05G062300	`PF29477`	COS111_C	53	70	0.067	13.6
TkA05G062300	`PF19729`	LRR_FBXL18	58	108	0.1	11.7
TkA05G062300	`PF23952`	LRR_EndoS	58	108	0.17	12.9
TkA05G062300	`PF13516`	LRR_6	59	72	0.029	15.1
TkA05G062300	`PF25013`	LRR_Zer-1	68	134	0.0044	17.9
TkA05G062300	`PF13516`	LRR_6	71	88	0.029	15.1
TkA05G062300	`PF24758`	LRR_At5g56370	72	107	0.24	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LB33`	Arabidopsis thaliana	sp\|Q8LB33\|FB330_ARATH F-box protein At3g58530	66.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card