TkA05G058000 | RubberDandelionOmics

Gene overview

TkA05G058000

Reference: TK1151 Chr: Chr05 Coordinates: 15437776-15440885 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1419 bp · TkA05G058000|TK1151|cDNA

AAAAAACTGGTCGACCTCCAATCAGTGATAGCTCTTCGAAATTTCTTCCAACAAGATCATAATCAACAACGAACAAGATAATTCAGTCCGACTGTGACAGTTAAATATATATATTTTTTTCCGATTTCGGGTTTGAAACGTAACTCAAAACATCACATAGCAAATAATCAGCAAACAACAAGATTAAGCAGTCCGACTGTGACTGTGAGGATTAATTTATATTTTTTCGATTTCGGGTTTGAAACGTAACTGGAAACATC...

CDS

Download CDS FASTA

735 bp · TkA05G058000|TK1151|CDS

ATGGAGGTCAATATATACTCGAATTCTTCACCACATGAGGTAGAACTTGTCTGTAACAATGAAGTTTCTGCAACTGTACTTGGTTATATTAATTTCATTAGCATCAGGAGCAACATCAGCGCCGATTTACGCGAGGCCTGGATGCAAAGATATGTGTGGGGGGATCCGGATTCCTTACCCATTTGGAATCGGAACAGGGTGTTATATCAACGAATGGTATGCCGTTGTTTGCAACTCATCGATACCATACCTTTCTGCGA...

Protein

Download Protein FASTA

244 aa · TkA05G058000|TK1151|PROTEIN

MEVNIYSNSSPHEVELVCNNEVSATVLGYINFISIRSNISADLREAWMQRYVWGDPDSLPIWNRNRVLYQRMVCRCLQLIDTIPFCDKQPQTIISEYGESNGGSYVSMSSDCTSPIRNNSQILSVNLGDSPFLFSRVDNKFTVEGCGNAVILEQENLVTGCSTICQNQTTSQRNNCYGSIVARSRFLTILNHTTSIQQACKCRVRVEFVGLPFWWMNNDTLLAGRLGNLPLLTIPLFQFHFGGL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G058000`
TK1151 ID	TkA05G058000
OH-1004 ID	LXL04_019525
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.300
Protein coverage (%)	TK1151 29.918 / OH-1004 7.841 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G058000`
Location	Chr05:15437776-15440885 (-)
Description	Similar to WAKL1: Wall-associated receptor kinase-like 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019525` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006952 defense response Biological Process GO:0007166 cell surface receptor signaling pathway Biological Process GO:0009617 response to bacterium Biological Process GO:0009620 response to fungus Biological Process GO:0009751 response to salicylic acid Biological Process GO:0046777 protein autophosphorylation Biological Process GO:0005576 extracellular region Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0009507 chloroplast Cellular Component GO:0004383 guanylate cyclase activity Molecular Function GO:0004674 protein serine/threonine kinase activity Molecular Function
KEGG gene cross-reference	ath:AT1G16120 ath:AT1G16130 ath:AT1G16260 ath:AT1G79670 ath:AT1G79680 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.339

Rank 1 · TkA05G058000 · TK1151

Cytoplasm0.338

Rank 2 · TkA05G058000 · TK1151

Cell membrane0.180

Rank 3 · TkA05G058000 · TK1151

Mitochondrion0.119

Rank 4 · TkA05G058000 · TK1151

Endoplasmic reticulum0.086

Rank 5 · TkA05G058000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04958AstA151-199 aa

PF06086Pox_A30L_A26L_N163-219 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G058000	`PF04958`	AstA	151	199	0.39	10.4
TkA05G058000	`PF06086`	Pox_A30L_A26L_N	163	219	0.2	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card