RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G035220
Reference: TK1151 Chr: Chr05 Coordinates: 9527411-9529327 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1138 bp · TkA05G035220|TK1151|cDNA

TATAATTGGAACTACAACTGGCGAGGGGTGTTTAATAATGGAAGAATATTATAATAAGTAGAAGGGCAAAGATTTTGAAAGCTCATATAACTTGTGATCACAACGCTTACCACGCAATTACAAAATTCATCTCCATCTTCATCTTCATCTTCATCTTCATCAAGAATTAAGACACTTGCTCTCTAAAAAGTGCGTGGATCAGGTCTAGTGTAATATTTCAAGAAAAAGATGGGTTACTGGAAGTCAACAGTGGTACCAAA...

CDS

Download CDS FASTA

609 bp · TkA05G035220|TK1151|CDS

ATGGGTTACTGGAAGTCAACAGTGGTACCAAAGTTCAAGAAGATATTCGAGAAGAACAACGGTAAGAAAGCCGCTGCTGCAGAAGCTTGCAAGACCTTCGATGACGCTAAGGAGGATTACAGCAAAGAGTTTGAAGAAAAGAAGAGTGAACTCCAAGCTAAAGTCATCGAAATCTATGAAGCTTCTGCTGATGAAATCAAGGCAGTTGTGAAGGAGAAGAAGGAAGGCGCCTTGAAAAAGGTATCCACTGGTGTTGAGAA...

Protein

Download Protein FASTA

202 aa · TkA05G035220|TK1151|PROTEIN

MGYWKSTVVPKFKKIFEKNNGKKAAAAEACKTFDDAKEDYSKEFEEKKSELQAKVIEIYEASADEIKAVVKEKKEGALKKVSTGVEKFLEELSKIEFPGSKPAHEACCKFGPTLVEGPIFFVFEKVSTFIVVEEKKEEETPAPEAPPAAAAPVEESSSKEKEIVVEEEKKEEVVAVAEVEKAPETTPAKAEEVAPTEPPKAC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G035220
TK1151 IDTkA05G035220
OH-1004 IDLXL04_019264
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.500
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G035220
LocationChr05:9527411-9529327 (+)
DescriptionSimilar to PCAP1: Plasma membrane-associated cation-binding protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g20260 May be involved in intracellular signaling through interaction with PtdInsPs and calmodulin (CaM); may keep PtdInsPs attached to the plasma membrane until Ca(2+)-CaM reaches a competitive concentration subsequent to an increase triggered by a stimulus, thus leading to PtdInsPs release and subsequent activation of InsPs-dependent signaling cascade.
Molecular properties of a novel, hydrophilic cation-binding protein associated with the plasma membrane.2007 · DOI: 10.1093/jxb/erl284
A hydrophilic cation-binding protein of Arabidopsis thaliana, AtPCaP1, is localized to plasma membrane via N-myristoylation and interacts with calmodulin and the phosphatidylinositol phosphates PtdIns(3,4,5)P(3) and PtdIns(3,5)P(2).2008 · DOI: 10.1111/j.1742-4658.2008.06379.x
PCaPs, possible regulators of PtdInsP signals on plasma membrane.2010 · DOI: 10.4161/psb.5.7.11825
MDP25, a novel calcium regulatory protein, mediates hypocotyl cell elongation by destabilizing cortical microtubules in Arabidopsis.2011 · DOI: 10.1105/tpc.111.092684
Interaction of the trans-frame potyvirus protein P3N-PIPO with host protein PCaP1 facilitates potyvirus movement.2012 · DOI: 10.1371/journal.ppat.1002639

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2WMG6 Salt stress root protein RS1. No verified direct reference in this release
Os01g0233000 Salt stress root protein RS1. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_019264 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006499 N-terminal protein myristoylation Biological Process
GO:0009409 response to cold Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0010350 cellular response to magnesium starvation Biological Process
GO:0031115 negative regulation of microtubule polymerization Biological Process
GO:0031117 positive regulation of microtubule depolymerization Biological Process
GO:0035865 cellular response to potassium ion Biological Process
GO:0043622 cortical microtubule organization Biological Process
GO:0051511 negative regulation of unidimensional cell growth Biological Process
GO:0051592 response to calcium ion Biological Process
GO:0071219 cellular response to molecule of bacterial origin Biological Process
GO:0071280 cellular response to copper ion Biological Process
KEGG gene cross-reference
ath:AT4G20260
dosa:Os01g0233000
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.532
Rank 1 · TkA05G035220 · TK1151
Cell membrane0.244
Rank 2 · TkA05G035220 · TK1151
Nucleus0.153
Rank 3 · TkA05G035220 · TK1151
Endoplasmic reticulum0.089
Rank 4 · TkA05G035220 · TK1151
Mitochondrion0.063
Rank 5 · TkA05G035220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05558DREPP1-195 aa
PF08148DSHCT12-79 aa
PF08148DSHCT127-175 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G035220PF05558DREPP11951.2e-73248.1
TkA05G035220PF08148DSHCT12791.49.4
TkA05G035220PF08148DSHCT1271751.49.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q96262Arabidopsis thalianasp|Q96262|PCAP1_ARATH Plasma membrane-associated cation-binding protein 163.100%Swiss-ProtMedium
A2WMG6Oryza sativa subsp. indicasp|A2WMG6|SRS1_ORYSI Salt stress root protein RS148.400%Swiss-ProtMedium
Q0JPA6Oryza sativa subsp. japonicasp|Q0JPA6|SRS1_ORYSJ Salt stress root protein RS148.400%Swiss-ProtMedium

JBrowse

View in Genome Browser