TkA05G023660 | RubberDandelionOmics

Gene overview

TkA05G023660

Reference: TK1151 Chr: Chr05 Coordinates: 6425943-6431149 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1139 bp · TkA05G023660|TK1151|cDNA

AATCGTTTCGTATTTGCTAATTGTTAGCTACCGCTATCTATTTTTGCCTTTCTGGATTAGGCTTTATAGTTGAATGTACACGACTCCGCGCTATAAACCCACTACACATGTTTCTTGCGGAAATGATCTGGGGTTAGTACAGCTCGAAACAATGGTCGGGCCAAGAAGGCCACAGTTCGTGCTGTTCGGTTCCTCGATCGTTCAATTTAGCTTCGGTGAGGAAGGTTGGGGTGCGATTCTTGCAGACATTTACGCTCGCA...

CDS

Download CDS FASTA

747 bp · TkA05G023660|TK1151|CDS

ATGTACACGACTCCGCGCTATAAACCCACTACACATGTTTCTTGCGGAAATGATCTGGGGTTAGTACAGCTCGAAACAATGGTCGGGCCAAGAAGGCCACAGTTCGTGCTGTTCGGTTCCTCGATCGTTCAATTTAGCTTCGGTGAGGAAGGTTGGGGTGCGATTCTTGCAGACATTTACGCTCGCAAGGCAGACATATTTATGCGAGGATATGCCGGTTGGAACTCTAGGCAAGCTGTACAAGTTCTGGATCAAGTTTT...

Protein

Download Protein FASTA

248 aa · TkA05G023660|TK1151|PROTEIN

MYTTPRYKPTTHVSCGNDLGLVQLETMVGPRRPQFVLFGSSIVQFSFGEEGWGAILADIYARKADIFMRGYAGWNSRQAVQVLDQVFPKDETVQPSLVIVYFGGNDSVLPSPDGLSPHIPLSEYVENMRKIAIHLKSLSEKTRIIFLTAPPVNEVQILQVLGTKGRTNELCKKYADACVRLCREMNIKVINLCNTLKQRDDWLTTCFTDGIHLSPVGSKIVAKEILKVIMEADWKPSLDWESLPVEFG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G023660`
TK1151 ID	TkA05G023660
OH-1004 ID	LXL04_019157
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G023660

Location Chr05:6425943-6431149 (-)

Description Similar to CPRD49: GDSL esterase/lipase CPRD49

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11210`	GDSL esterase/lipase CPRD49.	No verified direct reference in this release
`At2g38180`	GDSL esterase/lipase At2g38180.	No verified direct reference in this release
`At5g45920`	GDSL esterase/lipase At5g45920.	No verified direct reference in this release
`At5g62930`	GDSL esterase/lipase At5g62930.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0708400`	Involved in the organization of leaf cuticle and wax crystals.	Mutation in Wilted Dwarf and Lethal 1 (WDL1) causes abnormal cuticle formation and rapid water loss in rice.2010 · DOI: 10.1007/s11103-010-9656-x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019157 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT2G38180

ath:AT3G11210

ath:AT5G45920

ath:AT5G62930

dosa:Os11g0708400

osa:4351232

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.616

Rank 1 · TkA05G023660 · TK1151

Nucleus0.306

Rank 2 · TkA05G023660 · TK1151

Mitochondrion0.097

Rank 3 · TkA05G023660 · TK1151

Peroxisome0.076

Rank 4 · TkA05G023660 · TK1151

Cell membrane0.065

Rank 5 · TkA05G023660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657Lipase_GDSL36-225 aa

PF13472Lipase_GDSL_237-219 aa

PF04311DUF45993-227 aa

PF12651RHH_3119-127 aa

PF12651RHH_3131-144 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G023660	`PF00657`	Lipase_GDSL	36	225	3.4e-19	70.5
TkA05G023660	`PF13472`	Lipase_GDSL_2	37	219	4.5e-21	76.9
TkA05G023660	`PF04311`	DUF459	93	227	0.0031	17.6
TkA05G023660	`PF12651`	RHH_3	119	127	0.21	12.3
TkA05G023660	`PF12651`	RHH_3	131	144	0.21	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRM5`	Arabidopsis thaliana	sp\|Q9SRM5\|CPR49_ARATH GDSL esterase/lipase CPRD49	64.600%	Swiss-Prot	High
`O80443`	Arabidopsis thaliana	sp\|O80443\|GDL46_ARATH GDSL esterase/lipase At2g38180	66.400%	Swiss-Prot	High
`Q6NMR9`	Arabidopsis thaliana	sp\|Q6NMR9\|GDL84_ARATH GDSL esterase/lipase At5g45920	44.000%	Swiss-Prot	Medium
`Q9FM04`	Arabidopsis thaliana	sp\|Q9FM04\|GDL88_ARATH GDSL esterase/lipase At5g62930	37.800%	Swiss-Prot	Medium
`Q7XXR3`	Oryza sativa subsp. japonica	sp\|Q7XXR3\|WDL1_ORYSJ GDSL esterase/lipase WDL1	64.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card