TkA05G005190 | RubberDandelionOmics

Gene overview

TkA05G005190

Reference: TK1151 Chr: Chr05 Coordinates: 1530311-1535668 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2824 bp · TkA05G005190|TK1151|cDNA

TCTAAATCCAGAGTATCCTCTCTCTCTCTCTCTCTCTCTCTCTCCATAGAATTATCTTTTGGTTCATGGAAATCATATAGACACACACTTTGGCTGATCACTTGTATTCCAAACGCACACACTTTTGTATTTCCTTGTCTATTCTGTGTGTATAAACTTGGTGCTGGCTAGTCTAGTTCAATTGATGATCGTAACTGCCGAAAGTTTTATGCTTTTTGGTTGCATAGTTGAATACAATCATTTTACACTTGGGAGAGTTG...

CDS

Download CDS FASTA

1233 bp · TkA05G005190|TK1151|CDS

ATGGCGGTGGATGTTACCTCATGCACTAGAGGAGATGAAGTAAGCAGCAATAGCAATGATGAAGAAAACAGTTGTTCTGGGTGTGGTTCAGTTTCAGGAGAGAAAAGTAGAGGAGTAGATTTGTTAAAGCATGAAAGTGAGAGTTGTGAATGGAAACCTCTTGAGAAAGACTTATATGTGAAGGGATTAGAGATATTTGGGAGAAACAGCTGCCTGATAAGCAGAAACTTGCTTTGTGGGTTAAAAAGTTGCATACAAGT...

Protein

Download Protein FASTA

410 aa · TkA05G005190|TK1151|PROTEIN

MAVDVTSCTRGDEVSSNSNDEENSCSGCGSVSGEKSRGVDLLKHESESCEWKPLEKDLYVKGLEIFGRNSCLISRNLLCGLKSCIQVANYMYDNGSGAETSWSMLNGNGRADANPKEQETGASRARLVRRKGRAKKVKYSWKSGGHPSLMWRRIADGKNASCKQYIPCGCKSMCGKECPCLDNATCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCPCFAAGRECDPDVCRNCWVSCGDGSVGEPPKRGEGHCANMRLLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G005190`
TK1151 ID	TkA05G005190
OH-1004 ID	LXL04_006805
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	62.200
Protein coverage (%)	TK1151 91.463 / OH-1004 40.808 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G005190

Location Chr05:1530311-1535668 (-)

Description Similar to CLF: Histone-lysine N-methyltransferase CLF

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02020`	Polycomb group (PcG) protein.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q84UI6`	Polycomb group (PcG) protein.	No verified direct reference in this release
`Os03g0307800`	Polycomb group (PcG) protein.	The rice enhancer of zeste [E(z)] genes SDG711 and SDG718 are respectively involved in long day and short day signaling to mediate the accurate photoperiod control of flowering time.2014 · DOI: 10.3389/fpls.2014.00591

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006805 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009294 DNA-mediated transformation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010048 vernalization response Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031507 heterochromatin formation Biological Process

KEGG gene cross-reference

ath:AT2G23380

dosa:Os03g0307800

dosa:Os06g0275500

osa:4340748

zma:541954

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.924

Rank 1 · TkA05G005190 · TK1151

Cytoplasm0.124

Rank 2 · TkA05G005190 · TK1151

Cell membrane0.036

Rank 3 · TkA05G005190 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA05G005190 · TK1151

Mitochondrion0.015

Rank 5 · TkA05G005190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00856SET40-52 aa

PF03638TCR167-200 aa

PF18264preSET_CXC178-196 aa

PF03638TCR202-233 aa

PF18264preSET_CXC203-234 aa

PF00856SET275-378 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G005190	`PF00856`	SET	40	52	6.7e-21	75.4
TkA05G005190	`PF03638`	TCR	167	200	0.00044	21.2
TkA05G005190	`PF18264`	preSET_CXC	178	196	1.4e-07	32.5
TkA05G005190	`PF03638`	TCR	202	233	0.00044	21.2
TkA05G005190	`PF18264`	preSET_CXC	203	234	1.4e-07	32.5
TkA05G005190	`PF00856`	SET	275	378	6.7e-21	75.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZSM8`	Arabidopsis thaliana	sp\|Q9ZSM8\|EZA1_ARATH Histone-lysine N-methyltransferase EZA1	74.700%	Swiss-Prot	High
`Q84UI6`	Oryza sativa subsp. indica	sp\|Q84UI6\|EZ1_ORYSI Histone-lysine N-methyltransferase EZ1	70.900%	Swiss-Prot	High
`Q10MI4`	Oryza sativa subsp. japonica	sp\|Q10MI4\|EZ1_ORYSJ Histone-lysine N-methyltransferase EZ1	70.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card