TkA04G400770 | RubberDandelionOmics

Gene overview

TkA04G400770

Reference: TK1151 Chr: Chr04 Coordinates: 100774451-100776914 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

945 bp · TkA04G400770|TK1151|cDNA

GGAACTGCCTCATTCTGTTTTTCTGTCCCACATTGCTCTATATTCACGCTTTCCACATTGTTGCTCTCGTAGGCAGTCACGCAGAAGGCAGAAATTTATGAAATTTCACCTGACGTTTAGACCTCTTTTGTGTTAAACATGGGTACCATATTCAAAGCAAGCTTGCTCTTATCATTCCTGTTGTGTCTTCTCTCACCTTCTGCATATTCAGCTTCTAATGGTGGATTGGTTAGAGTTAGTCTTAAAAAGAGGAAAATCAA...

CDS

Download CDS FASTA

807 bp · TkA04G400770|TK1151|CDS

ATGGGTACCATATTCAAAGCAAGCTTGCTCTTATCATTCCTGTTGTGTCTTCTCTCACCTTCTGCATATTCAGCTTCTAATGGTGGATTGGTTAGAGTTAGTCTTAAAAAGAGGAAAATCAACCAATTAAACAAACATGGTGGACATTCTTCCTTAAATGAAGAAAATCCTGGAAGAAATTCTGGTCTTTATGGTAACTTTAGGGATTCAGAAAGTGACATAATTTCTCTGAAAAACTACATGGATGCTCAGTATTATGG...

Protein

Download Protein FASTA

268 aa · TkA04G400770|TK1151|PROTEIN

MGTIFKASLLLSFLLCLLSPSAYSASNGGLVRVSLKKRKINQLNKHGGHSSLNEENPGRNSGLYGNFRDSESDIISLKNYMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACLFHSKYKSSQSSTYKKNGKSAAIRYGTGAISGFFSQDSIKLGDFVIKEQDFIEATKEPGVTFVAAKFDGILGLGFQEISVVMLFLIRYNMVDQGLVHEPVFSFWLNRNTSNEEGGELVFGGVDTNHFKGKHTYVPVTQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G400770`
TK1151 ID	TkA04G400770
OH-1004 ID	LXL04_038170
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.500
Protein coverage (%)	TK1151 98.881 / OH-1004 52.165 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G400770

Location Chr04:100774451-100776914 (+)

Description Similar to CYPRO1: Cyprosin (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g11910`	Involved in the breakdown of propeptides of storage proteins in protein-storage vacuoles (By similarity).	No verified direct reference in this release
`At4g04460`	Involved in the processing and degradation of storage proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0567100`	Involved in the breakdown of propeptides of storage proteins in protein-storage vacuoles.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038170 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0071484 cellular response to light intensity Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0000326 protein storage vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0004175 endopeptidase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G11910

ath:AT1G62290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.362

Rank 1 · TkA04G400770 · TK1151

Lysosome / Vacuole0.357

Rank 2 · TkA04G400770 · TK1151

Cytoplasm0.143

Rank 3 · TkA04G400770 · TK1151

Endoplasmic reticulum0.116

Rank 4 · TkA04G400770 · TK1151

Cell membrane0.105

Rank 5 · TkA04G400770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00026Asp84-267 aa

PF14543TAXi_N85-243 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G400770	`PF00026`	Asp	84	267	2.4e-74	251.3
TkA04G400770	`PF14543`	TAXi_N	85	243	1.5e-14	55.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65390`	Arabidopsis thaliana	sp\|O65390\|APA1_ARATH Aspartic proteinase A1	66.900%	Swiss-Prot	High
`Q9XEC4`	Arabidopsis thaliana	sp\|Q9XEC4\|APA3_ARATH Aspartic proteinase A3	62.800%	Swiss-Prot	High
`Q42456`	Oryza sativa subsp. japonica	sp\|Q42456\|ASPR1_ORYSJ Aspartic proteinase oryzasin-1	66.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card