LXL04_038170 | RubberDandelionOmics

Gene overview

LXL04_038170

Reference: OH-1004 Chr: Chr09 Coordinates: 32852340-32857502 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1527 bp · LXL04_038170|LXL04_038170|OH1004|cDNA

ATGGGTACCATATTCAAAGCAAGCTTCCTCTTATCATTCCTGTTGTGTCTTCTCTCACCTTCTGCATATTCAGCTTCTAATGGTGGATTGGTTAGAGTTAGTCTTAAAAAGAGGAAAATCAACCAATTAAACAAACATGGTGGACATTCTTCCATAAATGAAGGAAATCCTGGAAGAAATTCTGGTCTTTATGATAACTTTAGGGATTCAGAAAGTGACATAATATCTCTGAAAAACTACATGGATGCTCAGTATTATGG...

CDS

Download CDS FASTA

1527 bp · LXL04_038170|LXL04_038170|OH1004|CDS

ATGGGTACCATATTCAAAGCAAGCTTCCTCTTATCATTCCTGTTGTGTCTTCTCTCACCTTCTGCATATTCAGCTTCTAATGGTGGATTGGTTAGAGTTAGTCTTAAAAAGAGGAAAATCAACCAATTAAACAAACATGGTGGACATTCTTCCATAAATGAAGGAAATCCTGGAAGAAATTCTGGTCTTTATGATAACTTTAGGGATTCAGAAAGTGACATAATATCTCTGAAAAACTACATGGATGCTCAGTATTATGG...

Protein

Download Protein FASTA

508 aa · LXL04_038170|LXL04_038170|OH1004|PROTEIN

MGTIFKASFLLSFLLCLLSPSAYSASNGGLVRVSLKKRKINQLNKHGGHSSINEGNPGRNSGLYDNFRDSESDIISLKNYMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACLFHSKYKSSQSSTYKKNGKSAAIRYGTGAISGFFSQDSIKLGDFVIKEQDFIEATKEPGVTFVAAKFDGILGLGFREISVGDALPVWYNMVDQGLVHEPVFSFWLNRNTSNEEGGELVFGGVDTNHFKGKHTYVPVTQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038170`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038170

Location Chr09:32852340-32857502 (+)

Description Similar to CYPRO1: Cyprosin (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g11910`	Involved in the breakdown of propeptides of storage proteins in protein-storage vacuoles (By similarity).	No verified direct reference in this release
`At1g62290`	Involved in the breakdown of propeptides of storage proteins in protein-storage vacuoles.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0567100`	Involved in the breakdown of propeptides of storage proteins in protein-storage vacuoles.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038170 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0071484 cellular response to light intensity Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0000326 protein storage vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0004175 endopeptidase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G11910

ath:AT1G62290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.432

Rank 1 · LXL04_038170 · OH-1004

Extracellular0.299

Rank 2 · LXL04_038170 · OH-1004

Cytoplasm0.155

Rank 3 · LXL04_038170 · OH-1004

Cell membrane0.130

Rank 4 · LXL04_038170 · OH-1004

Endoplasmic reticulum0.113

Rank 5 · LXL04_038170 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00026.29Asp84-507 aa

PF14543.12TAXi_N85-243 aa

PF03489.23SapB_2319-351 aa

PF05184.21SapB_1381-417 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038170	`PF00026.29`	Asp	84	507	3.7e-117	392.0
LXL04_038170	`PF14543.12`	TAXi_N	85	243	1.8e-13	51.8
LXL04_038170	`PF03489.23`	SapB_2	319	351	4e-12	46.8
LXL04_038170	`PF05184.21`	SapB_1	381	417	1.2e-13	51.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65390`	Arabidopsis thaliana	Aspartic proteinase A1	66.733%	Swiss-Prot	strong database homology
`Q8VYL3`	Arabidopsis thaliana	Aspartic proteinase A2	63.158%	Swiss-Prot	strong database homology
`Q42456`	Oryza sativa subsp. japonica	Aspartic proteinase oryzasin-1	65.361%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card