TkA04G056180 | RubberDandelionOmics

Gene overview

TkA04G056180

Reference: TK1151 Chr: Chr04 Coordinates: 14968391-14970182 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

932 bp · TkA04G056180|TK1151|cDNA

ATGTATGTTAAGACCAAAAAAAATAAGACCAAATCAATCTTGGCCATCCATTTCAATAAATTTTGAATCTAAGGGATTAGAAACCATTTCACGCGGATCATCATTTGTGTTTCACACGGATCGCCATCTGCATCTCCTTCCCTCTCTCTATTTACCAAGATTTGAATTGAAACACAGATTTGAGGGTTCAGCCTCGATCCGCTTGCACAGCCATCTGCATCTCCTTCCCTGCACTCCTTCCCCGATGGCGCGATACCTCA...

CDS

Download CDS FASTA

393 bp · TkA04G056180|TK1151|CDS

ATGTTAAGACCAAAAAAAATAAGACCAAATCAATCTTGGCCATCCATTTCAATAAATTTTGAATCTAAGGGATTAGAAACCATTTCACGCGGATCATCATTTGTGTTTCACACGGATCGCCATCTGCATCTCCTTCCCTCTCTCTATTTACCAAGATTTGAATTGAAACACAGATTTGAGGGTTCAGCCTCGATCCGCTTGCACAGCCATCTGCATCTCCTTCCCTGCACTCCTTCCCCGATGGCGCGATACCTCACGCG...

Protein

Download Protein FASTA

130 aa · TkA04G056180|TK1151|PROTEIN

MLRPKKIRPNQSWPSISINFESKGLETISRGSSFVFHTDRHLHLLPSLYLPRFELKHRFEGSASIRLHSHLHLLPCTPSPMARYLTRALLPRWRDAFSDFHRCGIIPVKELSVSEKRDLPIDVGSFLWFS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G056180`
TK1151 ID	TkA04G056180
OH-1004 ID	LXL04_015863
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.600
Protein coverage (%)	TK1151 32.308 / OH-1004 10.881 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G056180`
Location	Chr04:14968391-14970182 (-)
Description	Similar to DRP3A: Dynamin-related protein 3A
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015863` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000266 mitochondrial fission Biological Process GO:0006897 endocytosis Biological Process GO:0006907 pinocytosis Biological Process GO:0006909 phagocytosis Biological Process GO:0006997 nucleus organization Biological Process GO:0007005 mitochondrion organization Biological Process GO:0007015 actin filament organization Biological Process GO:0007032 endosome organization Biological Process GO:0007163 establishment or maintenance of cell polarity Biological Process GO:0009617 response to bacterium Biological Process GO:0016559 peroxisome fission Biological Process GO:0044375 regulation of peroxisome size Biological Process
KEGG gene cross-reference	ath:AT2G14120 ath:AT4G33650 bta:540892 ddi:DDB_G0277849 tgo:TGME49_267800 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.478

Rank 1 · TkA04G056180 · TK1151

Cytoplasm0.408

Rank 2 · TkA04G056180 · TK1151

Cell membrane0.119

Rank 3 · TkA04G056180 · TK1151

Endoplasmic reticulum0.084

Rank 4 · TkA04G056180 · TK1151

Mitochondrion0.079

Rank 5 · TkA04G056180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00699Urease_beta5-37 aa

PF00699Urease_beta53-74 aa

PF00699Urease_beta109-129 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G056180	`PF00699`	Urease_beta	5	37	0.13	13.0
TkA04G056180	`PF00699`	Urease_beta	53	74	0.13	13.0
TkA04G056180	`PF00699`	Urease_beta	109	129	0.13	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card