TkA03G569710 | RubberDandelionOmics

Gene overview

TkA03G569710

Reference: TK1151 Chr: Chr03 Coordinates: 144490578-144501486 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2118 bp · TkA03G569710|TK1151|cDNA

AAACTGTCTCATCGTTCCCAATTCCCGCTCTTCTTTATACCAGCGGTCTCTCTTCAACTCCGACCCACCGGAATCCTCAAGCTAAACCATTCAGGAGCATCCAATCTCGAGGAACTCATTAAGAGATGGAAGCTCAAAGCCAAAGTTTGGACAGAATCAGCGGTCTTCCTGAAGATACAGTTGAAAAAATTCTGAGTCATATGCCTATCCGAGATGCAGTGAGGACGAGCATCTTGTCAAGGAAATGGAGGCATTCGTGG...

CDS

Download CDS FASTA

1158 bp · TkA03G569710|TK1151|CDS

ATGGAAGCTCAAAGCCAAAGTTTGGACAGAATCAGCGGTCTTCCTGAAGATACAGTTGAAAAAATTCTGAGTCATATGCCTATCCGAGATGCAGTGAGGACGAGCATCTTGTCAAGGAAATGGAGGCATTCGTGGACGAACATGCCAATGATTGTATTTGATGATGACCTCGTTAATGTATTATCTGATTCGGAGGAAGAAATCGATAAATATAAGTTTTTCAGTCTCATCTTTCACATTCTGTTGCTACATAAGGGTCC...

Protein

Download Protein FASTA

385 aa · TkA03G569710|TK1151|PROTEIN

MEAQSQSLDRISGLPEDTVEKILSHMPIRDAVRTSILSRKWRHSWTNMPMIVFDDDLVNVLSDSEEEIDKYKFFSLIFHILLLHKGPISELSICFTDTERMRGIINEIDPIIHHLSWSKSIKTFVLDVTYFDDYYKLPRSLFSMQGLEHLSLKDCKIDLPLMFNGFNMLKSLVFNDVDITASTLRRILTSCPLLEKFTLIRDKQIELTECEFVELFNCLPSIQVLEISQLDIMHFTVDNIPHKLPVTLPHLRVLVLDVCC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G569710`
TK1151 ID	TkA03G569710
OH-1004 ID	LXL04_011161
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 97.662 / OH-1004 38.525 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G569710

Location Chr03:144490578-144501486 (+)

Description Similar to At1g13570: F-box/FBD/LRR-repeat protein At1g13570

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13570`	F-box/FBD/LRR-repeat protein At1g13570.	No verified direct reference in this release
`At5g52460`	Putative F-box/FBD/LRR-repeat protein At5g52460.	No verified direct reference in this release
`At5g56420`	F-box/FBD/LRR-repeat protein At5g56420.	No verified direct reference in this release
`At4g00160`	F-box/FBD/LRR-repeat protein At4g00160.	No verified direct reference in this release
`At3g26922`	F-box/LRR-repeat protein At3g26922.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011161 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G13570

ath:AT2G04230

ath:AT3G26922

ath:AT5G53840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.626

Rank 1 · TkA03G569710 · TK1151

Cytoplasm0.531

Rank 2 · TkA03G569710 · TK1151

Endoplasmic reticulum0.053

Rank 3 · TkA03G569710 · TK1151

Cell membrane0.043

Rank 4 · TkA03G569710 · TK1151

Mitochondrion0.019

Rank 5 · TkA03G569710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box11-49 aa

PF12937F-box-like11-42 aa

PF30487Ropporin_M30-76 aa

PF02394IL1_propep39-68 aa

PF15100TMEM18764-95 aa

PF24758LRR_At5g56370118-202 aa

PF23622LRR_At1g61320_AtMIF1119-239 aa

PF23598LRR_14125-283 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G569710	`PF00646`	F-box	11	49	6.2e-10	39.3
TkA03G569710	`PF12937`	F-box-like	11	42	0.0058	17.1
TkA03G569710	`PF30487`	Ropporin_M	30	76	0.3	12.1
TkA03G569710	`PF02394`	IL1_propep	39	68	0.021	16.3
TkA03G569710	`PF15100`	TMEM187	64	95	0.071	13.4
TkA03G569710	`PF24758`	LRR_At5g56370	118	202	1.2e-12	48.7
TkA03G569710	`PF23622`	LRR_At1g61320_AtMIF1	119	239	1.8e-09	38.2
TkA03G569710	`PF23598`	LRR_14	125	283	0.00047	19.7
TkA03G569710	`PF13855`	LRR_8	137	171	1.1	9.7
TkA03G569710	`PF00646`	F-box	184	195	6.2e-10	39.3
TkA03G569710	`PF08387`	FBD	187	199	0.00014	22.4
TkA03G569710	`PF24758`	LRR_At5g56370	216	284	1.2e-12	48.7
TkA03G569710	`PF13855`	LRR_8	216	228	1.1	9.7
TkA03G569710	`PF23622`	LRR_At1g61320_AtMIF1	217	348	1.8e-09	38.2
TkA03G569710	`PF30487`	Ropporin_M	217	232	0.3	12.1
TkA03G569710	`PF13855`	LRR_8	229	256	1.1	9.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ70`	Arabidopsis thaliana	sp\|Q9FZ70\|FDL1_ARATH F-box/FBD/LRR-repeat protein At1g13570	26.400%	Swiss-Prot	Low
`Q9FHB5`	Arabidopsis thaliana	sp\|Q9FHB5\|FDL42_ARATH Putative F-box/FBD/LRR-repeat protein At5g52460	29.700%	Swiss-Prot	Low
`Q9FM89`	Arabidopsis thaliana	sp\|Q9FM89\|FDL38_ARATH F-box/FBD/LRR-repeat protein At5g56420	31.200%	Swiss-Prot	Medium
`Q8LF09`	Arabidopsis thaliana	sp\|Q8LF09\|FDL23_ARATH F-box/FBD/LRR-repeat protein At4g00160	27.700%	Swiss-Prot	Low
`Q9LJF8`	Arabidopsis thaliana	sp\|Q9LJF8\|FBL47_ARATH F-box/LRR-repeat protein At3g26922	30.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card