LXL04_011161 | RubberDandelionOmics

Gene overview

LXL04_011161

Reference: OH-1004 Chr: Chr02 Coordinates: 159166648-159173080 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2931 bp · LXL04_011161|LXL04_011161|OH1004|cDNA

ATGGAAGCTCAAAGCCAAAGTTTGGATAGAATCAGCGCTCTTCCTGAAGATACAATTGAAAAAATTCTGAGTCATATGCCTATCCGAGATGCAGTGAGGACGAGCATCTTGTCAAGGAAATGGAGGCATTCGTGGACGAACATGCCAATGATTGTATTTGATGATGACCTCGTTAATGTATTATCTGATTCGGAGGAAGAAATCGATAAATATAAGTTTTTCAGTCTCATCTTTCACATTCTGTTGCTACATAAGGGTCC...

CDS

Download CDS FASTA

2931 bp · LXL04_011161|LXL04_011161|OH1004|CDS

ATGGAAGCTCAAAGCCAAAGTTTGGATAGAATCAGCGCTCTTCCTGAAGATACAATTGAAAAAATTCTGAGTCATATGCCTATCCGAGATGCAGTGAGGACGAGCATCTTGTCAAGGAAATGGAGGCATTCGTGGACGAACATGCCAATGATTGTATTTGATGATGACCTCGTTAATGTATTATCTGATTCGGAGGAAGAAATCGATAAATATAAGTTTTTCAGTCTCATCTTTCACATTCTGTTGCTACATAAGGGTCC...

Protein

Download Protein FASTA

976 aa · LXL04_011161|LXL04_011161|OH1004|PROTEIN

MEAQSQSLDRISALPEDTIEKILSHMPIRDAVRTSILSRKWRHSWTNMPMIVFDDDLVNVLSDSEEEIDKYKFFSLIFHILLLHKGPISELSICFTDTERMRGIINEIDPIIHHLSWSKSIKTFVLDVTYFDDYYKLPRSLFSMQGLEHLSLKDCKIDLPLMFNGFNMLKSLVFNDVDITASTLRRILTSCPLLEKFTLIRDKQIELTECEFVELFNCLPSIQVLEISQLDIMHFTVDNIPHKLPVTLPHLRVLVLDVCC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011161`
TK1151 ID	TkA03G569710
OH-1004 ID	LXL04_011161
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 97.662 / OH-1004 38.525 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011161

Location Chr02:159166648-159173080 (+)

Description Similar to At1g13570: F-box/FBD/LRR-repeat protein At1g13570

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13570`	F-box/FBD/LRR-repeat protein At1g13570.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release
`At5g53840`	F-box/FBD/LRR-repeat protein At5g53840.	No verified direct reference in this release
`At3g26922`	F-box/LRR-repeat protein At3g26922.	No verified direct reference in this release
`At5g56420`	F-box/FBD/LRR-repeat protein At5g56420.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011161 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G13570

ath:AT2G04230

ath:AT3G26922

ath:AT5G53840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.727

Rank 1 · LXL04_011161 · OH-1004

Nucleus0.340

Rank 2 · LXL04_011161 · OH-1004

Cell membrane0.073

Rank 3 · LXL04_011161 · OH-1004

Endoplasmic reticulum0.067

Rank 4 · LXL04_011161 · OH-1004

Mitochondrion0.045

Rank 5 · LXL04_011161 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646.39F-box11-49 aa

PF24758.2LRR_At5g56370119-202 aa

PF23622.2LRR_At1g61320_AtMIF1119-240 aa

PF23622.2LRR_At1g61320_AtMIF1425-519 aa

PF24758.2LRR_At5g56370432-520 aa

PF08387.16FBD630-666 aa

PF14244.13Retrotran_gag_3751-779 aa

PF14223.15Retrotran_gag_2760-871 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011161	`PF00646.39`	F-box	11	49	2.2e-09	37.6
LXL04_011161	`PF24758.2`	LRR_At5g56370	119	202	9.2e-23	81.8
LXL04_011161	`PF23622.2`	LRR_At1g61320_AtMIF1	119	240	1.6e-18	68.0
LXL04_011161	`PF23622.2`	LRR_At1g61320_AtMIF1	425	519	1.6e-18	68.0
LXL04_011161	`PF24758.2`	LRR_At5g56370	432	520	9.2e-23	81.8
LXL04_011161	`PF08387.16`	FBD	630	666	1.2e-11	45.0
LXL04_011161	`PF14244.13`	Retrotran_gag_3	751	779	5.7e-08	33.2
LXL04_011161	`PF14223.15`	Retrotran_gag_2	760	871	3.8e-10	40.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ70`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At1g13570	26.905%	Swiss-Prot	weak database homology
`Q6NKX3`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At2g04230	29.915%	Swiss-Prot	weak database homology
`Q9FGQ3`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At5g53840	29.412%	Swiss-Prot	weak database homology
`Q9LJF8`	Arabidopsis thaliana	F-box/LRR-repeat protein At3g26922	29.596%	Swiss-Prot	weak database homology
`Q9FM89`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At5g56420	31.373%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card