RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G565430
Reference: TK1151 Chr: Chr03 Coordinates: 143476465-143478496 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1326 bp · TkA03G565430|TK1151|cDNA

ATAAAGGAAAGCCAAAAATATTAAAAAGAAAACAAAGGGGACTAGAGTGTCATTTAAGAAATGAACAGGGGGTCTGTAAATCACTTCAATTCTTTAAGCTATGTTTCCAGCCGCCGGAAACTCATTTCCCACCACCGGTGCATCCATCGATGGCGGACTCGGAACATCCGCGTCTTGTCCTCCACGACTTTCTCTCCTTGAACTCTGCAAGGAACTTGAATTCATACACAAGAGCTGCAGTACAATCGGATACAGAGAAA...

CDS

Download CDS FASTA

1026 bp · TkA03G565430|TK1151|CDS

ATGTTTCCAGCCGCCGGAAACTCATTTCCCACCACCGGTGCATCCATCGATGGCGGACTCGGAACATCCGCGTCTTGTCCTCCACGACTTTCTCTCCTTGAACTCTGCAAGGAACTTGAATTCATACACAAGAGCTGCAGTACAATCGGATACAGAGAAAATGTGTTTTCCACTACTCTTTCTCATCTCATAGCCACTAACTCTCCTCATTTGATTCTTCCCTTTCTTCCGATTCGAGAGAAGCTCAAAGAGAAAGTCGA...

Protein

Download Protein FASTA

341 aa · TkA03G565430|TK1151|PROTEIN

MFPAAGNSFPTTGASIDGGLGTSASCPPRLSLLELCKELEFIHKSCSTIGYRENVFSTTLSHLIATNSPHLILPFLPIREKLKEKVEEYFGCEYELFIEFTGLISWCKGASIGWHSDDNRPYLKQRDYAAVCYLNSHCVDFNGGLFHFQDGNPTTFIPMAGDVLIYTADTRNVHSVEEITNGERLTLTLWFTRDKSHDEDSKLISSLSKHKINSCDSCPKPYLPFPASQNMYWFPPEQSLTYNSGFDTRYARLHVLGYQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G565430
TK1151 IDTkA03G565430
OH-1004 IDLXL04_011105
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)98.400
Protein coverage (%)TK1151 89.736 / OH-1004 35.789
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G565430
LocationChr03:143476465-143478496 (+)
DescriptionSimilar to P3H1: Prolyl 3-hydroxylase 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_011105 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006457 protein folding Biological Process
GO:0008285 negative regulation of cell population proliferation Biological Process
GO:0018126 protein hydroxylation Biological Process
GO:0019511 peptidyl-proline hydroxylation Biological Process
GO:0030199 collagen fibril organization Biological Process
GO:0030278 regulation of ossification Biological Process
GO:0030308 negative regulation of cell growth Biological Process
GO:0032963 collagen metabolic process Biological Process
GO:0050708 regulation of protein secretion Biological Process
GO:0050821 protein stabilization Biological Process
GO:1901874 negative regulation of post-translational protein modification Biological Process
GO:1904027 negative regulation of collagen fibril organization Biological Process
KEGG gene cross-reference
gga:414142
hsa:64175
mmu:210530
mmu:56401
rno:114200
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.401
Rank 1 · TkA03G565430 · TK1151
Nucleus0.332
Rank 2 · TkA03G565430 · TK1151
Mitochondrion0.135
Rank 3 · TkA03G565430 · TK1151
Endoplasmic reticulum0.125
Rank 4 · TkA03G565430 · TK1151
Peroxisome0.073
Rank 5 · TkA03G565430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF136402OG-FeII_Oxy_3109-191 aa
PF09859Oxygenase-NA158-191 aa
PF09859Oxygenase-NA292-321 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G565430PF136402OG-FeII_Oxy_31091914.6e-1144.2
TkA03G565430PF09859Oxygenase-NA1581910.2911.4
TkA03G565430PF09859Oxygenase-NA2923210.2911.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser