Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2618 bp · LXL04_011105|LXL04_011105|OH1004|cDNA
ATGTTCTCCAGCCGCCGGAAACTCATTTCCCACCACCGGTGCATCCATCGATGGCGGACTCGGAACATCCGCGTCTTGTCCTCCACGACTTTCTCTCCTCTGAACTCTGCAAGGAACTTGAATTCATACACAAGAGCTGCAGTACAATCGGATACAGAGAAAATGTGTTTTCCACTACTCTTTCTCATCTCATAGCCACTAACTCTCCTCATTTGATTCTTCCCTTTCTTCCGATTCGAGAGAAGCTCAAAGAGAAAGTC...
2568 bp · LXL04_011105|LXL04_011105|OH1004|CDS
ATGGCGGACTCGGAACATCCGCGTCTTGTCCTCCACGACTTTCTCTCCTCTGAACTCTGCAAGGAACTTGAATTCATACACAAGAGCTGCAGTACAATCGGATACAGAGAAAATGTGTTTTCCACTACTCTTTCTCATCTCATAGCCACTAACTCTCCTCATTTGATTCTTCCCTTTCTTCCGATTCGAGAGAAGCTCAAAGAGAAAGTCGAAGAATATTTTGGTTGTGAATATGAACTCTTCATCGAATTCACTGGTCT...
Protein
Download Protein FASTA855 aa · LXL04_011105|LXL04_011105|OH1004|PROTEIN
MADSEHPRLVLHDFLSSELCKELEFIHKSCSTIGYRENVFSTTLSHLIATNSPHLILPFLPIREKLKEKVEEYFGCEYELFIEFTGLISWCKGASIGWHSDDNRPYLKQRDYAAVCYLNSHGVDFNGGLFHFQDGNPTTFIPMAGDVLIYTADTRNVHSVEEITNGERLTLTLWFTRDKSHDEDSKLISSLSKHKINSCDSCPKPYLPFPASQNMYWFPPEQSLTYQSGFDTRYARLHVLGYQLCCKDARVKSSFDFSDI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_011105 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_011105 |
|---|---|
| Location | Chr02:157935042-157939989 (+) |
| Description | Similar to P3H1: Prolyl 3-hydroxylase 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006457 protein folding Biological Process GO:0008285 negative regulation of cell population proliferation Biological Process GO:0018126 protein hydroxylation Biological Process GO:0019511 peptidyl-proline hydroxylation Biological Process GO:0030199 collagen fibril organization Biological Process GO:0030278 regulation of ossification Biological Process GO:0030308 negative regulation of cell growth Biological Process GO:0032963 collagen metabolic process Biological Process GO:0050708 regulation of protein secretion Biological Process GO:0050821 protein stabilization Biological Process GO:1901874 negative regulation of post-translational protein modification Biological Process GO:1904027 negative regulation of collagen fibril organization Biological Process |
| KEGG gene cross-reference | gga:414142 hsa:64175 mmu:210530 mmu:56401 rno:114200 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13640.132OG-FeII_Oxy_393-175 aaPF03478.25Beta-prop_KIB1-4535-817 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_011105 | PF13640.13 | 2OG-FeII_Oxy_3 | 93 | 175 | 7.9e-11 | 43.5 |
| LXL04_011105 | PF03478.25 | Beta-prop_KIB1-4 | 535 | 817 | 1.2e-37 | 130.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.