TkA03G561860 | RubberDandelionOmics

Gene overview

TkA03G561860

Reference: TK1151 Chr: Chr03 Coordinates: 142618406-142619815 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

755 bp · TkA03G561860|TK1151|cDNA

CACGAGTTGGCGTCTGAAATCCTGAATCCGCTCCCCCTATACCAGCGACATAAATCTGCGGCTCCATACCTGCTTTCTTCTTTGTTGTCAACACCAAATCCGCTCATCATCGATGAAGAAGTAACATGTTTCCGATCGTAGGCTCTATCTGTCTCTCTCTATTTTCTCCGATTTTTCTCTTGCTCCAACGTCTCCACAAAGATGCCGATCTCGATTAATCAAGGATTCAATCGGTGTTTACTTCAAATTTTCATTTCCCG...

CDS

Download CDS FASTA

492 bp · TkA03G561860|TK1151|CDS

ATGGGTTTCTTAAAGATCTGCCCAGATCCGGCGACTTTTCCGCAAGCAACAGCAACAGAGACAGATGGAATTGAGCAATTTAAGTATGCGAATTCCGACTTTTCATCATTTGGTGAAAGAGGCAATTGGGTTTTTGGAATTGGGTTTCAACATAGGCAATCGAGTTTTAAGGAGCTCCAATACAGACGTGATGGAGATAGCAATGGAGTTCTATATTATGTCGGCACATCATATGGGAAACACCAATGGGTCAATCCTGT...

Protein

Download Protein FASTA

163 aa · TkA03G561860|TK1151|PROTEIN

MGFLKICPDPATFPQATATETDGIEQFKYANSDFSSFGERGNWVFGIGFQHRQSSFKELQYRRDGDSNGVLYYVGTSYGKHQWVNPVLAKKISITASNPISRYTDAKVLASRTYQGISFAGPRIEDGRSSWSMIDLGLDHQLMCNYYTLRQDGSKAFMRQWNF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G561860`
TK1151 ID	TkA03G561860
OH-1004 ID	LXL04_011046
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 86.503 / OH-1004 45.631 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G561860

Location Chr03:142618406-142619815 (+)

Description Similar to At2g30600/At2g30610: BTB/POZ domain-containing protein At2g30600

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q8LEV3`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011046 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0042659 regulation of cell fate specification Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0045746 negative regulation of Notch signaling pathway Biological Process

GO:0045747 positive regulation of Notch signaling pathway Biological Process

GO:0051865 protein autoubiquitination Biological Process

GO:0070373 negative regulation of ERK1 and ERK2 cascade Biological Process

GO:0070534 protein K63-linked ubiquitination Biological Process

GO:1902882 regulation of response to oxidative stress Biological Process

KEGG gene cross-reference

ath:AT2G30600

cel:CELE_C34D4.14

dme:Dmel_CG5604

hsa:25831

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.787

Rank 1 · TkA03G561860 · TK1151

Cytoplasm0.089

Rank 2 · TkA03G561860 · TK1151

Endoplasmic reticulum0.042

Rank 3 · TkA03G561860 · TK1151

Mitochondrion0.037

Rank 4 · TkA03G561860 · TK1151

Nucleus0.035

Rank 5 · TkA03G561860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00673Ribosomal_L5_C34-77 aa

PF00673Ribosomal_L5_C103-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G561860	`PF00673`	Ribosomal_L5_C	34	77	0.1	13.4
TkA03G561860	`PF00673`	Ribosomal_L5_C	103	145	0.1	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LEV3`	Arabidopsis thaliana	sp\|Q8LEV3\|Y2060_ARATH BTB/POZ domain-containing protein At2g30600	75.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card