TkA03G544930 | RubberDandelionOmics

Gene overview

TkA03G544930

Reference: TK1151 Chr: Chr03 Coordinates: 137456652-137462585 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1764 bp · TkA03G544930|TK1151|cDNA

ACCAAATTTCGACTTTTTATTATGGTCTCGCCTAAGTATATACAATTAGATAATATAGACTAATGGAGCAAATATGCATTCAGCGTCCTAGTTTGCATCTGTAGCCGACAGACGTTAGAGGGGTGTCTTTGTAGGGAGACACTATGGGACATTGGCGTATCAACCCATACAATAAAACTTCACTTTGAGTCGAGCTTAATTAGAGCAACTCAAGAATCTTCGATCGGGGTTAAGATTGAATAATAGCTAGTGTACGAGGA...

CDS

Download CDS FASTA

1074 bp · TkA03G544930|TK1151|CDS

ATGGGGAGTTCACCTGAGACGGAACATCCTGTGAAAGCCTTGGGCTACGCCGCTAGAGACACATCTGGCGTACTCTCCCCCATTAACTTCTCCCGGAGGGAAACGGGAGATGAAGACGTAAGGTTCAAAGTCTTGTACTGCGGAATCTGTCACACTGATCTTCACTTTATAAAAAATGAATGGAACAACACCAAATACCCCGTGATCCCAGGCCATGAGATTGTGGGTGTGGTAACTGAAATCGGCAAGAAAGTCAATAA...

Protein

Download Protein FASTA

357 aa · TkA03G544930|TK1151|PROTEIN

MGSSPETEHPVKALGYAARDTSGVLSPINFSRRETGDEDVRFKVLYCGICHTDLHFIKNEWNNTKYPVIPGHEIVGVVTEIGKKVNKVKVGDKVGVGCIVGSCHSCDQCGSNQEQFCPKMVSTYNDSTTVTYGGYSDHMVANEHFIITWPKDYPLDGGAPLLCAGITVYSPIRYYGLDKPDMNVGVVGLGGLGHVAVKFLKALGVKVTVISTSPKKKEEAVNNFGADSFLVSRDQEQMAGGVGSLDGIIDTVSADHPLVP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G544930`
TK1151 ID	TkA03G544930
OH-1004 ID	LXL04_010723
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.000
Protein coverage (%)	TK1151 99.720 / OH-1004 99.720 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G544930`
Location	Chr03:137456652-137462585 (+)
Description	Similar to CAD: Probable mannitol dehydrogenase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010723` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009809 lignin biosynthetic process Biological Process GO:0009820 alkaloid metabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Molecular Function GO:0045551 cinnamyl-alcohol dehydrogenase activity Molecular Function GO:0046029 mannitol dehydrogenase activity Molecular Function GO:0047924 geraniol dehydrogenase activity Molecular Function GO:0050624 vomilenine reductase activity Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.730

Rank 1 · TkA03G544930 · TK1151

Nucleus0.275

Rank 2 · TkA03G544930 · TK1151

Mitochondrion0.104

Rank 3 · TkA03G544930 · TK1151

Peroxisome0.071

Rank 4 · TkA03G544930 · TK1151

Cell membrane0.060

Rank 5 · TkA03G544930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08240ADH_N36-150 aa

PF00070Pyr_redox71-94 aa

PF21799MurD-like_N119-149 aa

PF028262-Hacid_dh_C174-222 aa

PF01488Shikimate_DH181-259 aa

PF02629CoA_binding181-216 aa

PF00899ThiF182-206 aa

PF01262AlaDh_PNT_C183-253 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G544930	`PF08240`	ADH_N	36	150	1.2e-25	90.5
TkA03G544930	`PF00070`	Pyr_redox	71	94	0.075	14.3
TkA03G544930	`PF21799`	MurD-like_N	119	149	0.021	15.8
TkA03G544930	`PF02826`	2-Hacid_dh_C	174	222	2.3e-05	24.5
TkA03G544930	`PF01488`	Shikimate_DH	181	259	0.015	16.1
TkA03G544930	`PF02629`	CoA_binding	181	216	0.77	11.3
TkA03G544930	`PF00899`	ThiF	182	206	0.073	12.9
TkA03G544930	`PF01262`	AlaDh_PNT_C	183	253	0.00021	21.5
TkA03G544930	`PF03446`	NAD_binding_2	183	255	0.015	16.1
TkA03G544930	`PF21799`	MurD-like_N	183	216	0.021	15.8
TkA03G544930	`PF22660`	RS_preATP-grasp-like	183	222	0.11	13.6
TkA03G544930	`PF02737`	3HCDH_N	183	225	0.12	13.0
TkA03G544930	`PF00070`	Pyr_redox	184	215	0.075	14.3
TkA03G544930	`PF16912`	Glu_dehyd_C	185	279	0.0025	18.0
TkA03G544930	`PF02254`	TrkA_N	186	224	0.077	14.0
TkA03G544930	`PF00107`	ADH_zinc_N	191	314	1.3e-20	74.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card