TkA03G070620 | RubberDandelionOmics

Gene overview

TkA03G070620

Reference: TK1151 Chr: Chr03 Coordinates: 18191144-18192006 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

783 bp · TkA03G070620|TK1151|cDNA

ATGAAGAAGGTGAATTCGAAGGCTTCTACACATTACATTCCCAAGACCAATTGCCATTGTGTCCAACACGTGGATACATTGAACGACAATCATATTATTCTATGGAACCCTTCAATCAGGCGCACACTAATTTTACCTGATTGTCCTCGGAGATGCTATTCTGCATCCGAGATTGGGTTCGGTTACGATCCAATCACCGATGATCACAAGGTTGTAAGCGTCCCGGGAGTTATTGGAGAACACGTAGAACTTGCATATGT...

CDS

Download CDS FASTA

783 bp · TkA03G070620|TK1151|CDS

ATGAAGAAGGTGAATTCGAAGGCTTCTACACATTACATTCCCAAGACCAATTGCCATTGTGTCCAACACGTGGATACATTGAACGACAATCATATTATTCTATGGAACCCTTCAATCAGGCGCACACTAATTTTACCTGATTGTCCTCGGAGATGCTATTCTGCATCCGAGATTGGGTTCGGTTACGATCCAATCACCGATGATCACAAGGTTGTAAGCGTCCCGGGAGTTATTGGAGAACACGTAGAACTTGCATATGT...

Protein

Download Protein FASTA

260 aa · TkA03G070620|TK1151|PROTEIN

MKKVNSKASTHYIPKTNCHCVQHVDTLNDNHIILWNPSIRRTLILPDCPRRCYSASEIGFGYDPITDDHKVVSVPGVIGEHVELAYVYSIKKNAWCAISSHMPVYRRVSLTSRACFVSVALHWLVQLFGEREFFIMKFDLSKHVFSHVPSPEPRWTKGPTAVHGCLAVVTEQSLTENWIWVRRGDSWCVVFKLKEADDLGGALQLGTDGVLVFDMVFGFQVYNPKTGAYPRLVDFNYDSFLLEICQCDESLRFLDIGISC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G070620`
TK1151 ID	TkA03G070620
OH-1004 ID	LXL04_006777
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.600
Protein coverage (%)	TK1151 89.615 / OH-1004 76.375 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G070620

Location Chr03:18191144-18192006 (+)

Description Similar to At3g16210: Putative F-box protein At3g16210

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16210`	Putative F-box protein At3g16210.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006777 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G12190

ath:AT1G47790

ath:AT3G06240

ath:AT3G16210

ath:AT3G23880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.611

Rank 1 · TkA03G070620 · TK1151

Nucleus0.403

Rank 2 · TkA03G070620 · TK1151

Cell membrane0.109

Rank 3 · TkA03G070620 · TK1151

Endoplasmic reticulum0.075

Rank 4 · TkA03G070620 · TK1151

Lysosome / Vacuole0.045

Rank 5 · TkA03G070620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08268FBA_316-181 aa

PF07734FBA_126-171 aa

PF01344Kelch_168-100 aa

PF01344Kelch_1136-151 aa

PF01344Kelch_1172-190 aa

PF08268FBA_3211-229 aa

PF01344Kelch_1220-227 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G070620	`PF08268`	FBA_3	16	181	3e-13	50.2
TkA03G070620	`PF07734`	FBA_1	26	171	3.2e-09	37.0
TkA03G070620	`PF01344`	Kelch_1	68	100	0.084	13.1
TkA03G070620	`PF01344`	Kelch_1	136	151	0.084	13.1
TkA03G070620	`PF01344`	Kelch_1	172	190	0.084	13.1
TkA03G070620	`PF08268`	FBA_3	211	229	3e-13	50.2
TkA03G070620	`PF01344`	Kelch_1	220	227	0.084	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LU24`	Arabidopsis thaliana	sp\|Q9LU24\|FB145_ARATH Putative F-box protein At3g16210	30.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card