TkA02G525100 | RubberDandelionOmics

Gene overview

TkA02G525100

Reference: TK1151 Chr: Chr02 Coordinates: 135398730-135399824 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1095 bp · TkA02G525100|TK1151|cDNA

ATGGGTACCTCATTGTTGATTACAGCCGTTTTGGTGTTGGTTGTCGGAACTGCCGTTAATGGCTGTCCACCGTCGGATAGGGCGGCGTTGCTGGCGTTTAAAGCTGCCTTACAAGAGCCTTACTTGGGGATCTTTAAGTCGTGGAAGGGCGTCGACTGTTGTCATAAATGGTACGGTGTTAGTTGCGACCCGACTACTAAACGGGTTGCCGACATAAACCTCCGTGGAGAGTCGGAAGACCCGATTTTCCAGAAGGCTCG...

CDS

Download CDS FASTA

1095 bp · TkA02G525100|TK1151|CDS

ATGGGTACCTCATTGTTGATTACAGCCGTTTTGGTGTTGGTTGTCGGAACTGCCGTTAATGGCTGTCCACCGTCGGATAGGGCGGCGTTGCTGGCGTTTAAAGCTGCCTTACAAGAGCCTTACTTGGGGATCTTTAAGTCGTGGAAGGGCGTCGACTGTTGTCATAAATGGTACGGTGTTAGTTGCGACCCGACTACTAAACGGGTTGCCGACATAAACCTCCGTGGAGAGTCGGAAGACCCGATTTTCCAGAAGGCTCG...

Protein

Download Protein FASTA

364 aa · TkA02G525100|TK1151|PROTEIN

MGTSLLITAVLVLVVGTAVNGCPPSDRAALLAFKAALQEPYLGIFKSWKGVDCCHKWYGVSCDPTTKRVADINLRGESEDPIFQKARRTGYMNGTISPAICKLTRLSSVIIADWKGISGVIPPCISSLPFLRILDLIGNQISGEIPYDIGKLSHLTVLNIADNRITGRMPRSIADLSSLMHLDLRNNLISGTIPQNFGKLRMLSRALLSGNRIYGPIPYTITYIYRLSDLDLSLNRISGPVPESLGRMAVLATLNLDGNN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G525100`
TK1151 ID	TkA02G525100
OH-1004 ID	LXL04_012989
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G525100

Location Chr02:135398730-135399824 (-)

Description Similar to DRT100: DNA damage-repair/toleration protein DRT100

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12610`	This protein is able to complement bacterial recA mutations, but its native function in the plant is not known.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012989 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0000166 nucleotide binding Molecular Function

KEGG gene cross-reference

ath:AT3G05660

ath:AT3G12610

vvi:100232865

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.485

Rank 1 · TkA02G525100 · TK1151

Extracellular0.267

Rank 2 · TkA02G525100 · TK1151

Endoplasmic reticulum0.106

Rank 3 · TkA02G525100 · TK1151

Cytoplasm0.072

Rank 4 · TkA02G525100 · TK1151

Plastid0.038

Rank 5 · TkA02G525100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_224-63 aa

PF12799LRR_498-108 aa

PF00560LRR_1117-128 aa

PF13855LRR_8118-141 aa

PF12799LRR_4120-141 aa

PF25013LRR_Zer-1125-187 aa

PF13516LRR_6129-144 aa

PF00560LRR_1131-152 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G525100	`PF08263`	LRRNT_2	24	63	4.2e-12	46.8
TkA02G525100	`PF12799`	LRR_4	98	108	1e-07	32.7
TkA02G525100	`PF00560`	LRR_1	117	128	1.9e-28	93.1
TkA02G525100	`PF13855`	LRR_8	118	141	9.1e-26	90.1
TkA02G525100	`PF12799`	LRR_4	120	141	1e-07	32.7
TkA02G525100	`PF25013`	LRR_Zer-1	125	187	0.067	14.1
TkA02G525100	`PF13516`	LRR_6	129	144	1.5e-07	31.7
TkA02G525100	`PF00560`	LRR_1	131	152	1.9e-28	93.1
TkA02G525100	`PF12799`	LRR_4	131	166	1e-07	32.7
TkA02G525100	`PF24141`	LRR_ComC	136	218	3.4e-05	24.4
TkA02G525100	`PF13516`	LRR_6	152	167	1.5e-07	31.7
TkA02G525100	`PF13855`	LRR_8	153	213	9.1e-26	90.1
TkA02G525100	`PF00560`	LRR_1	154	176	1.9e-28	93.1
TkA02G525100	`PF12799`	LRR_4	154	190	1e-07	32.7
TkA02G525100	`PF13516`	LRR_6	177	190	1.5e-07	31.7
TkA02G525100	`PF00560`	LRR_1	178	200	1.9e-28	93.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q00874`	Arabidopsis thaliana	sp\|Q00874\|DR100_ARATH DNA damage-repair/toleration protein DRT100	61.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card