LXL04_012989 | RubberDandelionOmics

Gene overview

LXL04_012989

Reference: OH-1004 Chr: Chr03 Coordinates: 21988160-21989254 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1095 bp · LXL04_012989|LXL04_012989|OH1004|cDNA

ATGGGTACCTCATTGTTGATTACAGCCGTTTTGGTGTTGGTTGTCGGAACTGCCGTTAATGGCTGTCCACCGTCGGATAGGGCGGCGTTGCTGGCGTTTAAAGCTGCCTTACATGAGCCTTACTTGGGGATCTTTAAGTCGTGGAAGGGCGTCGACTGTTGTCATAAATGGTACGGTGTTAGTTGCGACCCGACTACTAAACGGGTTGCCGACATAAACCTCCGTGGAGAGTCGGAAGACCCGATTTTCCAGAAGGCTCG...

CDS

Download CDS FASTA

1095 bp · LXL04_012989|LXL04_012989|OH1004|CDS

ATGGGTACCTCATTGTTGATTACAGCCGTTTTGGTGTTGGTTGTCGGAACTGCCGTTAATGGCTGTCCACCGTCGGATAGGGCGGCGTTGCTGGCGTTTAAAGCTGCCTTACATGAGCCTTACTTGGGGATCTTTAAGTCGTGGAAGGGCGTCGACTGTTGTCATAAATGGTACGGTGTTAGTTGCGACCCGACTACTAAACGGGTTGCCGACATAAACCTCCGTGGAGAGTCGGAAGACCCGATTTTCCAGAAGGCTCG...

Protein

Download Protein FASTA

364 aa · LXL04_012989|LXL04_012989|OH1004|PROTEIN

MGTSLLITAVLVLVVGTAVNGCPPSDRAALLAFKAALHEPYLGIFKSWKGVDCCHKWYGVSCDPTTKRVADINLRGESEDPIFQKARRTGYMNGTISPAICKLTRLSSVIIADWKGISGVIPPCISSLPFLRILDLIGNQISGEIPYDIGKLSHLTVLNIADNRITGRMPRSIADLSSLMHLDLRNNLISGTIPQNFGKLRMLSRALLSGNRIYGPIPYTITYIYRLSDLDLSLNRISGPVPESLGRMAVLATLNLDGNN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012989`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012989

Location Chr03:21988160-21989254 (+)

Description Similar to DRT100: DNA damage-repair/toleration protein DRT100

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12610`	This protein is able to complement bacterial recA mutations, but its native function in the plant is not known.	No verified direct reference in this release
`At3g05660`	Receptor-like protein 33.	No verified direct reference in this release
`At3g12145`	Promotes flowering transition in long days (LD).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012989 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0000166 nucleotide binding Molecular Function

KEGG gene cross-reference

ath:AT3G05660

ath:AT3G12610

vvi:100232865

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.484

Rank 1 · LXL04_012989 · OH-1004

Extracellular0.265

Rank 2 · LXL04_012989 · OH-1004

Endoplasmic reticulum0.108

Rank 3 · LXL04_012989 · OH-1004

Cytoplasm0.073

Rank 4 · LXL04_012989 · OH-1004

Plastid0.038

Rank 5 · LXL04_012989 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_224-63 aa

PF12799.14LRR_4131-166 aa

PF13855.13LRR_8153-213 aa

PF13855.13LRR_8225-261 aa

PF13855.13LRR_8273-332 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012989	`PF08263.18`	LRRNT_2	24	63	3.6e-12	47.1
LXL04_012989	`PF12799.14`	LRR_4	131	166	1e-07	32.7
LXL04_012989	`PF13855.13`	LRR_8	153	213	1e-25	90.0
LXL04_012989	`PF13855.13`	LRR_8	225	261	1e-25	90.0
LXL04_012989	`PF13855.13`	LRR_8	273	332	1e-25	90.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q00874`	Arabidopsis thaliana	DNA damage-repair/toleration protein DRT100	58.140%	Swiss-Prot	strong database homology
`F4J8G2`	Arabidopsis thaliana	Receptor-like protein 33	33.036%	Swiss-Prot	moderate database homology
`Q9LH52`	Arabidopsis thaliana	Leucine-rich repeat protein FLOR 1	31.594%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card