TkA02G511130 | RubberDandelionOmics

Gene overview

TkA02G511130

Reference: TK1151 Chr: Chr02 Coordinates: 131242890-131245266 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2044 bp · TkA02G511130|TK1151|cDNA

AAAAAATACCAACCCAGAGTCCTCAGGAACCGAAAGGGCTAGAAGAAAGGAAGATAAACCTCTCCACCTTGACGCCTGATAACGAAACCAAAATCTGCAACTACAGTAGCTACGAAGAGCACCGAGTCTTCATCACGTTTTCCATGCATTTTGATCCAGAATTGTAAAATTAAGGTCACAATTTGGACGAAGCATGTCTACGAACAACAATAATCCCCCAAATAAGCCTAATGCATCTTCTCCTTTCGGACATTATCCAC...

CDS

Download CDS FASTA

1596 bp · TkA02G511130|TK1151|CDS

ATGTCTACGAACAACAATAATCCCCCAAATAAGCCTAATGCATCTTCTCCTTTCGGACATTATCCACCGCCAAACCCTACCGCGCATCTCCAGTCACAGACACAGTCCCAAACTCAACAACCGTACGGACCTCCCTTCACGAATCAGTTTCAGCTCTCCCAATTCGCTGCGACCCATACCCAAGCCATGGCTCAAGCGCAATCTAAAGTTCAGGCTAAAGTTGCGGCTCAAGCTCAAGCCACCCACGCCCAATTCCAAGC...

Protein

Download Protein FASTA

531 aa · TkA02G511130|TK1151|PROTEIN

MSTNNNNPPNKPNASSPFGHYPPPNPTAHLQSQTQSQTQQPYGPPFTNQFQLSQFAATHTQAMAQAQSKVQAKVAAQAQATHAQFQAQLQAQGVTVPSNQSHGPLSTNSPSFPSGISSTKRMPQRPVGRPPGVSNSNTISPIRSMELKPGSRSKKKQKVSGKQLQERIASILPQSTLYTQLLEFESRVDGALMRKKMDIQEAIKNPPCIQKNLRIYVFNTFSNQTNTNSKIPNTEPPTWTMKIVGRILEEGMDPDQAGLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G511130`
TK1151 ID	TkA02G511130
OH-1004 ID	LXL04_013217
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 96.422 / OH-1004 94.118 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G511130

Location Chr02:131242890-131245266 (+)

Description Similar to At5g14170: SWI/SNF complex component SNF12 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14170`	Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013217 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006337 nucleosome disassembly Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010224 response to UV-B Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0010971 positive regulation of G2/M transition of mitotic cell cycle Biological Process

GO:0030071 regulation of mitotic metaphase/anaphase transition Biological Process

KEGG gene cross-reference

ath:AT5G14170

dme:Dmel_CG4303

hsa:6602

mmu:66993

mmu:83797

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.927

Rank 1 · TkA02G511130 · TK1151

Cytoplasm0.169

Rank 2 · TkA02G511130 · TK1151

Mitochondrion0.017

Rank 3 · TkA02G511130 · TK1151

Cell membrane0.016

Rank 4 · TkA02G511130 · TK1151

Endoplasmic reticulum0.007

Rank 5 · TkA02G511130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04183IucA_IucC26-94 aa

PF29592SWIFT210-322 aa

PF02201SWIB329-401 aa

PF26291SWIB_eIF2D353-382 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G511130	`PF04183`	IucA_IucC	26	94	0.019	15.3
TkA02G511130	`PF29592`	SWIFT	210	322	2e-23	83.2
TkA02G511130	`PF02201`	SWIB	329	401	7.3e-25	87.2
TkA02G511130	`PF26291`	SWIB_eIF2D	353	382	0.29	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMT4`	Arabidopsis thaliana	sp\|Q9FMT4\|SNF12_ARATH SWI/SNF complex component SNF12 homolog	66.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card