LXL04_013217 | RubberDandelionOmics

Gene overview

LXL04_013217

Reference: OH-1004 Chr: Chr03 Coordinates: 26131100-26132824 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1635 bp · LXL04_013217|LXL04_013217|OH1004|cDNA

ATGTCTACGAACAACAATAATCCCCCAAATAACCCTAATGCATCTTCTCCTTTCGGACATTATCCACCGCCAAACCCTACCGCGCATCTCCAGTCACAGACACAGTCCCAAACTCAACAACCGTACGGACCTCCCTTCACGAATCAGTTTCAGCTCTCCCAATTCGCTGCGACCCATACCCAAGCCATGGCTCAAGCGCAATCTAAAGTTCAGGCTAAAGTTGCGGCTCAAGCTCAAGCCACCCACGCCCAATTCCAAGC...

CDS

Download CDS FASTA

1635 bp · LXL04_013217|LXL04_013217|OH1004|CDS

ATGTCTACGAACAACAATAATCCCCCAAATAACCCTAATGCATCTTCTCCTTTCGGACATTATCCACCGCCAAACCCTACCGCGCATCTCCAGTCACAGACACAGTCCCAAACTCAACAACCGTACGGACCTCCCTTCACGAATCAGTTTCAGCTCTCCCAATTCGCTGCGACCCATACCCAAGCCATGGCTCAAGCGCAATCTAAAGTTCAGGCTAAAGTTGCGGCTCAAGCTCAAGCCACCCACGCCCAATTCCAAGC...

Protein

Download Protein FASTA

544 aa · LXL04_013217|LXL04_013217|OH1004|PROTEIN

MSTNNNNPPNNPNASSPFGHYPPPNPTAHLQSQTQSQTQQPYGPPFTNQFQLSQFAATHTQAMAQAQSKVQAKVAAQAQATHAQFQAQLQAQGVTVPSNQSHGPLSTNSPSFPSGISSTKRMPQRPVGRPPGVSNSNTISPIRSMELTPGSRSKKKQKVSGKQLQERIASILPQSTLYTQLLEFESRVDAALMRKKMDIQEAIKNPPCIQKNLRIYVFNTFSNQTNTNSKIPNTEPPTWTMKIVGRILEEGMDPDQAGLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013217`
TK1151 ID	TkA02G511130
OH-1004 ID	LXL04_013217
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 96.422 / OH-1004 94.118 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013217

Location Chr03:26131100-26132824 (-)

Description Similar to At5g14170: SWI/SNF complex component SNF12 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14170`	Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013217 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006337 nucleosome disassembly Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010224 response to UV-B Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0010971 positive regulation of G2/M transition of mitotic cell cycle Biological Process

GO:0030071 regulation of mitotic metaphase/anaphase transition Biological Process

KEGG gene cross-reference

ath:AT5G14170

dme:Dmel_CG4303

hsa:6602

mmu:66993

mmu:83797

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.943

Rank 1 · LXL04_013217 · OH-1004

Cytoplasm0.156

Rank 2 · LXL04_013217 · OH-1004

Mitochondrion0.016

Rank 3 · LXL04_013217 · OH-1004

Cell membrane0.015

Rank 4 · LXL04_013217 · OH-1004

Endoplasmic reticulum0.006

Rank 5 · LXL04_013217 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29592.1SWIFT210-322 aa

PF02201.24SWIB329-401 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013217	`PF29592.1`	SWIFT	210	322	2.6e-23	82.9
LXL04_013217	`PF02201.24`	SWIB	329	401	7.6e-25	87.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMT4`	Arabidopsis thaliana	SWI/SNF complex component SNF12 homolog	66.968%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card