RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G421120
Reference: TK1151 Chr: Chr02 Coordinates: 106926441-106933240 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

5660 bp · TkA02G421120|TK1151|cDNA

ACTAAACGTCTAAGACCTACGGAAGAGTCCAACAACACCAAAAGTCCAAAACTGTAATTTACTTTTGAATTCGTCCGTTTTCCAGAACATAATATTAGCTGAGAAAATAACTGGCTCAAGTGTCATTCTTTTGTACACATAGTACTATTGGGCAAACTGTGGACCCTCAATTTCCTTCACTCGCGCACCCCTCCACTCGGCGCCACTTGCCGTCTACTACAGGGTCCATTATCTCCTAAAGACCTAAACCCTCGTCGCGA...

CDS

Download CDS FASTA

3774 bp · TkA02G421120|TK1151|CDS

ATGACAAACCCAAATTCAAGATCAAAAGCCTTTCATCTCCTCATACTACTATTCCTGTGTTTTATCCACCTGTGTTTCTCCAATGACACTTCATCATTGATAACTCTTCGAAAATTACTGCTTCAAAGAAAAGACGTTACATCAACATGGTTTGATTCAAACACACATCCATGTAACTGGACTGGCATAAGATGTGAAGGTTCTTCCGTTCATCAAATATCTCTCTCCTGTACATTCTCTCCACTCACTCTCCCATTCCC...

Protein

Download Protein FASTA

1257 aa · TkA02G421120|TK1151|PROTEIN

MTNPNSRSKAFHLLILLFLCFIHLCFSNDTSSLITLRKLLLQRKDVTSTWFDSNTHPCNWTGIRCEGSSVHQISLSCTFSPLTLPFPKTLQEFKSLKHLNVSGCGFNGRIYSDFWTLNDLETLDLSDNRLFGVLDNNTFSSLKKLKVLVLDSNRFSGSLPETIGQLGNLTELSVKSNSFSGRLPYEIGNLDKLQSLDLSLNLFSGDLPSSLGNLSKLLFLDASHNLFTGLLFSKIGNLKKLRTLDLSMNSFGGQIPGTIG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G421120
TK1151 IDTkA02G421120
OH-1004 IDLXL04_014496
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G421120
LocationChr02:106926441-106933240 (+)
DescriptionSimilar to MSP1: Leucine-rich repeat receptor protein kinase MSP1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g07280 Receptor with a serine/threonine-protein kinase activity required for the specification of the correct number of male archesporial initials and for the subsequent specification of tapetal and middle cell layer identities. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0917500 Receptor-like kinase that plays important roles in restricting the number of cells entering into male and female sporogenesis.
The MSP1 gene is necessary to restrict the number of cells entering into male and female sporogenesis and to initiate anther wall formation in rice.2003 · DOI: 10.1105/tpc.012401
Os02g0194400 Receptor-like kinase that may play a role male and female sporogenesis. No verified direct reference in this release
Os09g0293500 May be involved in brassenosteroid (BR) perception in roots.
The role of OsBRI1 and its homologous genes, OsBRL1 and OsBRL3, in rice.2006 · DOI: 10.1104/pp.105.072330
Os08g0342300 May be involved in brassenosteroid (BR) perception in roots.
The role of OsBRI1 and its homologous genes, OsBRL1 and OsBRL3, in rice.2006 · DOI: 10.1104/pp.105.072330
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_014496 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009414 response to water deprivation Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0009554 megasporogenesis Biological Process
GO:0009556 microsporogenesis Biological Process
GO:0009611 response to wounding Biological Process
GO:0009729 detection of brassinosteroid stimulus Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009755 hormone-mediated signaling pathway Biological Process
GO:0009791 post-embryonic development Biological Process
GO:0010234 anther wall tapetum cell fate specification Biological Process
GO:0042659 regulation of cell fate specification Biological Process
GO:0045184 establishment of protein localization Biological Process
KEGG gene cross-reference
ath:AT1G55610
ath:AT4G20140
ath:AT5G07280
dosa:Os01g0917500
dosa:Os02g0194400
osa:4324355
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.857
Rank 1 · TkA02G421120 · TK1151
Endoplasmic reticulum0.086
Rank 2 · TkA02G421120 · TK1151
Cytoplasm0.063
Rank 3 · TkA02G421120 · TK1151
Nucleus0.043
Rank 4 · TkA02G421120 · TK1151
Lysosome / Vacuole0.029
Rank 5 · TkA02G421120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_227-65 aa
PF24758LRR_At5g5637070-127 aa
PF12799LRR_481-104 aa
PF13855LRR_887-104 aa
PF25019LRR_R13L1-DRL2189-150 aa
PF23952LRR_EndoS89-128 aa
PF23598LRR_1490-176 aa
PF12799LRR_494-128 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G421120PF08263LRRNT_227655.1e-0833.8
TkA02G421120PF24758LRR_At5g56370701273.2e-0834.2
TkA02G421120PF12799LRR_4811047.3e-36122.1
TkA02G421120PF13855LRR_8871043.7e-48161.8
TkA02G421120PF25019LRR_R13L1-DRL21891507.3e-0729.9
TkA02G421120PF23952LRR_EndoS891280.0514.5
TkA02G421120PF23598LRR_14901761.3e-36126.8
TkA02G421120PF12799LRR_4941287.3e-36122.1
TkA02G421120PF00560LRR_1951171.9e-59185.4
TkA02G421120PF13516LRR_6951077.4e-0523.2
TkA02G421120PF25013LRR_Zer-11161993e-0731.4
TkA02G421120PF14580LRR_91161960.002718.0
TkA02G421120PF23211LRR_LRWD11161792.08.8
TkA02G421120PF13516LRR_61191297.4e-0523.2
TkA02G421120PF00560LRR_11201351.9e-59185.4
TkA02G421120PF13855LRR_81201783.7e-48161.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LYN8Arabidopsis thalianasp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS164.000%Swiss-ProtLow
Q8RZV7Oryza sativa subsp. japonicasp|Q8RZV7|MSP1_ORYSJ Leucine-rich repeat receptor protein kinase MSP157.900%Swiss-ProtMedium
Q7F8Q9Oryza sativa subsp. japonicasp|Q7F8Q9|MSL1_ORYSJ Leucine-rich repeat receptor protein kinase MSL157.700%Swiss-ProtLow
Q69JN6Oryza sativa subsp. japonicasp|Q69JN6|BRL1_ORYSJ Brassinosteroid LRR receptor kinase BRL149.700%Swiss-ProtLow
Q6ZCZ2Oryza sativa subsp. japonicasp|Q6ZCZ2|BRL3_ORYSJ Brassinosteroid LRR receptor kinase BRL355.100%Swiss-ProtLow

JBrowse

View in Genome Browser