Gene Card
Gene overview
cDNA / CDS / Protein Sequences
5399 bp · TkA02G209960|TK1151|cDNA
GAACAATGCTGACCGCATGATTTGAAATCGAACGGCGGTGATGCTCCTATTGTTGTATTTGTTTTTGTGATATAAATCCAATTTTCCCTCTCTCTCTCTAAGACCAAAACAAACCTAGCATTCTATATTTCTATTTCTCTCTCCGGGGTAAAAATATATAAAAATAAAAAAAGTTAAAATTGAAAAATAATTCGGCAAATGATCTTCAATTAGGGTTTCGAATCAGATGTCTGTTTTTGGGCGTATCAAATTCCGTGGTT...
1020 bp · TkA02G209960|TK1151|CDS
ATGATGTGGAAAGGAGGAAAGGATTGGGCGCTCGAGTTCCCAGACAGGACTCAGTGGGTCACATTTAAGGAACTTCACGAGGAGTGCCACAATCGGAACATACGTGCAGCATCGATTAAAAACATCCCGATCCCCGGTGTCCGGTTAATCGACGATTCGGTTAATTACACAGAAGAGACACCTTTTGTCAGAAGCTCGTGGTATTATCGCCAGGTCAGAAACGACATGGAGACGGCTATGGATGCATCGCGGGTCATGTA...
Protein
Download Protein FASTA339 aa · TkA02G209960|TK1151|PROTEIN
MMWKGGKDWALEFPDRTQWVTFKELHEECHNRNIRAASIKNIPIPGVRLIDDSVNYTEETPFVRSSWYYRQVRNDMETAMDASRVMYDMDSEDEEWVGRSRSREEDETISDEVFEKVMDMLEKVSYAQKRDHFTGGEVEELIARVTPMQVAKTIYDHWREKRHRKGMPLIRQLQPPLWERYQQICREWDQSHPHPHQQPKLTPSGSHSHSHSHSQSQEKAGDDKPPMFAFCLKPRGLEVLNKGSKHRPHKKISLSGHSHA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G209960 |
|---|---|
| TK1151 ID | TkA02G209960 |
| OH-1004 ID | LXL04_015820 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 89.900 |
| Protein coverage (%) | TK1151 95.575 / OH-1004 22.517Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G209960 |
|---|---|
| Location | Chr02:53581017-53587340 (-) |
| Description | Similar to TRX1: Histone-lysine N-methyltransferase TRX1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0007064 mitotic sister chromatid cohesion Biological Process GO:0009414 response to water deprivation Biological Process GO:0009556 microsporogenesis Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009908 flower development Biological Process GO:0009909 regulation of flower development Biological Process |
| KEGG gene cross-reference | ath:AT1G05830 ath:AT1G15940 ath:AT2G31650 ath:AT4G31880 dosa:Os09g0134500 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF10513EPL136-123 aaPF10513EPL1207-217 aaPF10513EPL1319-330 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G209960 | PF10513 | EPL1 | 36 | 123 | 3.3e-10 | 41.5 |
| TkA02G209960 | PF10513 | EPL1 | 207 | 217 | 3.3e-10 | 41.5 |
| TkA02G209960 | PF10513 | EPL1 | 319 | 330 | 3.3e-10 | 41.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.