TkA02G047640 | RubberDandelionOmics

Gene overview

TkA02G047640

Reference: TK1151 Chr: Chr02 Coordinates: 12327265-12329694 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1578 bp · TkA02G047640|TK1151|cDNA

CTGTTAGACGGTTACGAGGAATATAATTATGGTCCCGTACAATATGATCCTCCGCGGCCGCCGTCGTCGTCGTATTGCTCTCACGCGGTGTTCCTCCGACTTTTCCTCTGGTCCTTCACTTTTATAACAACACCTTCCCTGCCCACAATTCATGCTTCAGAATCTTTCCTCCATCCCCAACATTCTCCATTGATTGTCGCAAATCACCTGTTAATATCCATGATTCCCTCTAATTTATAAAACAATCGCCACAAGATGTT...

CDS

Download CDS FASTA

1038 bp · TkA02G047640|TK1151|CDS

ATGTTACGGAGGTGCGTGAAGCCGTTCGACAGATGCTTAGGACAACGAGCTGGTGGCGATAAACTCTTATGGCATACGGATTTGAAGCCTCACGCCTCCGGTGAGTTCTCAATCGCCGTCGTGCAAGCTAATTCTAGCCTCGAAGATCAAAGCCAGGTGTTCACGTCTCCGTCTGCGACCTATATCGGCGTTTACGACGGCCATGGCGGACCTGAAGCTTCTCGTTTTGTTAATCGCAACCTTTTCCCCTTGATCGACAA...

Protein

Download Protein FASTA

345 aa · TkA02G047640|TK1151|PROTEIN

MLRRCVKPFDRCLGQRAGGDKLLWHTDLKPHASGEFSIAVVQANSSLEDQSQVFTSPSATYIGVYDGHGGPEASRFVNRNLFPLIDKYATEEGGISADVIKKAFQTTEEGFFQLVKLSMPIRPQIASAGSCCLLGKSKLVAERLSNDHNVSIVEVRKEVQAQHPNDSHIVVYCHGVWRIKGIIQVSRSIGDFYLKKPEFNEDPYFMQYGNPITLNQPALTAEPSIISRKLKPQDSFLIFASDGLWENLSDQEAVDIVQKY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G047640`
TK1151 ID	TkA02G047640
OH-1004 ID	LXL04_013600
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	60.300
Protein coverage (%)	TK1151 96.522 / OH-1004 97.347 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G047640

Location Chr02:12327265-12329694 (-)

Description Similar to At4g33920: Probable protein phosphatase 2C 63

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33920`	May dephosphorylate and repress plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), thus influencing negatively plant growth and fitness.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0580900`	Probable protein phosphatase 2C 78.	No verified direct reference in this release
`UniProt: Q5MFV5`	Probable protein phosphatase 2C 34.	No verified direct reference in this release
`Os03g0761100`	Probable protein phosphatase 2C 34.	No verified direct reference in this release
`Os03g0207400`	Probable protein phosphatase 2C 29.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013600 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:1902531 regulation of intracellular signal transduction Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0004721 phosphoprotein phosphatase activity Molecular Function

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0004741 [pyruvate dehydrogenase (acetyl-transferring)]-phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G33920

dosa:Os03g0207400

dosa:Os03g0761100

dosa:Os12g0580900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.523

Rank 1 · TkA02G047640 · TK1151

Cytoplasm0.271

Rank 2 · TkA02G047640 · TK1151

Nucleus0.163

Rank 3 · TkA02G047640 · TK1151

Cell membrane0.087

Rank 4 · TkA02G047640 · TK1151

Peroxisome0.081

Rank 5 · TkA02G047640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00581Rhodanese48-74 aa

PF00481PP2C56-280 aa

PF00581Rhodanese149-178 aa

PF07228SpoIIE230-308 aa

PF00581Rhodanese272-300 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G047640	`PF00581`	Rhodanese	48	74	0.12	13.6
TkA02G047640	`PF00481`	PP2C	56	280	8.4e-27	95.2
TkA02G047640	`PF00581`	Rhodanese	149	178	0.12	13.6
TkA02G047640	`PF07228`	SpoIIE	230	308	0.062	13.9
TkA02G047640	`PF00581`	Rhodanese	272	300	0.12	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81760`	Arabidopsis thaliana	sp\|O81760\|P2C63_ARATH Probable protein phosphatase 2C 63	61.500%	Swiss-Prot	High
`Q2QN36`	Oryza sativa subsp. japonica	sp\|Q2QN36\|P2C78_ORYSJ Probable protein phosphatase 2C 78	56.600%	Swiss-Prot	High
`Q5MFV5`	Oryza sativa subsp. indica	sp\|Q5MFV5\|P2C34_ORYSI Probable protein phosphatase 2C 34	50.100%	Swiss-Prot	High
`Q94H98`	Oryza sativa subsp. japonica	sp\|Q94H98\|P2C34_ORYSJ Probable protein phosphatase 2C 34	50.100%	Swiss-Prot	High
`Q8H063`	Oryza sativa subsp. japonica	sp\|Q8H063\|P2C29_ORYSJ Probable protein phosphatase 2C 29	51.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card