TkA01G625870 | RubberDandelionOmics

Gene overview

TkA01G625870

Reference: TK1151 Chr: Chr01 Coordinates: 157991351-157996861 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2843 bp · TkA01G625870|TK1151|cDNA

TTGCTCTTTTGTTAATTTAAATGAAAAAGAAGAAAAACAAGCTTGAAAAAGCAAAGGAAAGAAAGAAGGAATGGTTGGTTTCCATTGCGCCTTTCTTTTTCTTGTTTCTCTCTGCTAAGCATCTTTTCTTTCCTTCACTTTTTTGGGTTCTTTTCTTAGTCTCTCAATCTCTCAAACACTAGACACTTTACCTTCTTGTAAAAAAAATTCTCTGAGTTCTCTACCTCAACCATTTCTTTATAATCTTCAGGATTTCCGTT...

CDS

Download CDS FASTA

1743 bp · TkA01G625870|TK1151|CDS

ATGGGACTTTGTCATGGAAAACCGAATCAGACCCTCGAAAGCCAACTCGAAAATTCCAATTTCCCAAATGAAATTGAACCAACAGCAGTGAATTCCCAAACAGGGAAATCATCATTCCCTTACTACAGTCCCAGTCCTTTCCATAACAGTAGCGCCTACAAGAATTCACCTGCGAATTCAAATTCAAGCGTCAGTTCGACGCCTCTTCGCATATTTAAACGCCCTTTCCCACCCCCATCACCTGCCAAACATATTCGATC...

Protein

Download Protein FASTA

580 aa · TkA01G625870|TK1151|PROTEIN

MGLCHGKPNQTLESQLENSNFPNEIEPTAVNSQTGKSSFPYYSPSPFHNSSAYKNSPANSNSSVSSTPLRIFKRPFPPPSPAKHIRSLLARRHGSVKPNEAPIPEGNEFEVGLDKNFGYSKQLLSHYELGEEVGRGHFGYTCTAKGKKGSMKGHDVAVKVIPKSKMTTVIAIEDARREVKILRALTGHDNLVQFYDAYEDEDNVYIIMELCKGGELLDRILARGGKYSEEDAKAVMVQILRVTAYCHLQGVVHRDLKPEN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G625870`
TK1151 ID	TkA01G625870
OH-1004 ID	LXL04_000245
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G625870

Location Chr01:157991351-157996861 (+)

Description Similar to CRK7: CDPK-related kinase 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56760`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`At2g41140`	May play a role in signal transduction pathways that involve calcium as a second messenger (By similarity).	The calmodulin-binding protein kinase 3 is part of heat-shock signal transduction in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2008.03544.x
`At3g50530`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0366200`	Possesses kinase activity in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000245 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010286 heat acclimation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004683 calcium/calmodulin-dependent protein kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0009931 calcium-dependent protein serine/threonine kinase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G41140

ath:AT3G50530

ath:AT3G56760

dosa:Os03g0366200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.373

Rank 1 · TkA01G625870 · TK1151

Cytoplasm0.359

Rank 2 · TkA01G625870 · TK1151

Nucleus0.230

Rank 3 · TkA01G625870 · TK1151

Golgi apparatus0.085

Rank 4 · TkA01G625870 · TK1151

Endoplasmic reticulum0.068

Rank 5 · TkA01G625870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase127-389 aa

PF07714PK_Tyr_Ser-Thr128-381 aa

PF03109ABC1152-167 aa

PF01636APH173-225 aa

PF06293Kdo203-277 aa

PF03109ABC1205-289 aa

PF14531Kinase-like234-337 aa

PF01636APH234-282 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G625870	`PF00069`	Pkinase	127	389	1.3e-71	241.8
TkA01G625870	`PF07714`	PK_Tyr_Ser-Thr	128	381	4.7e-32	112.0
TkA01G625870	`PF03109`	ABC1	152	167	0.00011	22.2
TkA01G625870	`PF01636`	APH	173	225	0.0032	18.0
TkA01G625870	`PF06293`	Kdo	203	277	4.5e-05	23.7
TkA01G625870	`PF03109`	ABC1	205	289	0.00011	22.2
TkA01G625870	`PF14531`	Kinase-like	234	337	0.00075	19.6
TkA01G625870	`PF01636`	APH	234	282	0.0032	18.0
TkA01G625870	`PF05235`	CHAD	343	403	0.12	13.1
TkA01G625870	`PF13499`	EF-hand_7	436	493	0.031	15.3
TkA01G625870	`PF13405`	EF-hand_6	436	461	0.087	13.3
TkA01G625870	`PF00036`	EF-hand_1	439	462	0.056	13.7
TkA01G625870	`PF00036`	EF-hand_1	489	496	0.056	13.7
TkA01G625870	`PF11154`	DUF2934	507	526	0.23	11.9
TkA01G625870	`PF13499`	EF-hand_7	513	568	0.031	15.3
TkA01G625870	`PF00036`	EF-hand_1	514	533	0.056	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LET1`	Arabidopsis thaliana	sp\|Q9LET1\|CAMK7_ARATH CDPK-related kinase 7	77.700%	Swiss-Prot	High
`O80673`	Arabidopsis thaliana	sp\|O80673\|CAMK1_ARATH CDPK-related kinase 1	76.200%	Swiss-Prot	High
`Q9SCS2`	Arabidopsis thaliana	sp\|Q9SCS2\|CAMK5_ARATH CDPK-related kinase 5	67.400%	Swiss-Prot	High
`Q10KY3`	Oryza sativa subsp. japonica	sp\|Q10KY3\|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1	67.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card