RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G620160
Reference: TK1151 Chr: Chr01 Coordinates: 156464535-156467470 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2032 bp · TkA01G620160|TK1151|cDNA

ACACTTTCACCCCCTTTTAAATAGCCCCAGCCGTCGAGCCACCCAATTTCTTCTCTCCCTCCCCAAAAGAAATATCTCCCACAAGAAATAACAGTACACTCATCATCTCTCTTAATTTCTCTCTCTCTCTCTCTCTCAAGAACAAAATAGAGAGTTAGAGACACATGAAGTTGAGGATGCACACACCAACCAAGCCTCTTTTGTTATATTAACCTGCTGATTTACTAGTAGCAAGTAAGTGTTTTTTGGCTAAAGGGATA...

CDS

Download CDS FASTA

1527 bp · TkA01G620160|TK1151|CDS

ATGTCTCTTGAGGATTCATTAAGATCTCTCTCTCTAGACTATCTAAATCTACTGATCAACGGGCAAGCCTTCAGCGACGTCACTTTCAGCGTGGAGGGAAGAATCGTCCATGCCCACCGCTGCATCCTGGCTGCTCGCAGCCTGTTCTTCAGAAAGTTCTTTTGCTCCGGCGGCACCGACTCTCCGACGGGGTCTGGATCGGATCCGTTAGGGTCGAGGATGGGTGTGGGTATGGGTATGGGACCCGCTTCCCCCAGGAA...

Protein

Download Protein FASTA

508 aa · TkA01G620160|TK1151|PROTEIN

MSLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCILAARSLFFRKFFCSGGTDSPTGSGSDPLGSRMGVGMGMGPASPRNSPSSQVVIPVNSVGYEVFLLMLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAVDLALDTLSAARSFGVEQLVLLTQKQLAIMVEKASIEDVMKVLLASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSIARRSLMPHHHQHHHHDLSVAADLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G620160
TK1151 IDTkA01G620160
OH-1004 IDLXL04_000316
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G620160
LocationChr01:156464535-156467470 (+)
DescriptionSimilar to NPR5: Regulatory protein NPR5
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g41370 May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).
The BLADE ON PETIOLE genes act redundantly to control the growth and development of lateral organs.2005 · DOI: 10.1242/dev.01815
BLADE-ON-PETIOLE-dependent signaling controls leaf and floral patterning in Arabidopsis.2005 · DOI: 10.1105/tpc.104.030536
BLADE-ON-PETIOLE 1 and 2 control Arabidopsis lateral organ fate through regulation of LOB domain and adaxial-abaxial polarity genes.2007 · DOI: 10.1105/tpc.107.051938
The BLADE-ON-PETIOLE genes are essential for abscission zone formation in Arabidopsis.2008 · DOI: 10.1242/dev.012807
BLADE-ON-PETIOLE1 coordinates organ determinacy and axial polarity in arabidopsis by directly activating ASYMMETRIC LEAVES2.2010 · DOI: 10.1105/tpc.109.070763
Control of Arabidopsis leaf morphogenesis through regulation of the YABBY and KNOX families of transcription factors.2010 · DOI: 10.1534/genetics.110.118703
Arabidopsis BLADE-ON-PETIOLE1 and 2 promote floral meristem fate and determinacy in a previously undefined pathway targeting APETALA1 and AGAMOUS-LIKE24.2010 · DOI: 10.1111/j.1365-313x.2010.04299.x

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_000316 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009609 response to symbiotic bacterium Biological Process
GO:0009864 induced systemic resistance, jasmonic acid mediated signaling pathway Biological Process
GO:0009877 nodulation Biological Process
GO:0009944 polarity specification of adaxial/abaxial axis Biological Process
GO:0009954 proximal/distal pattern formation Biological Process
GO:0010227 floral organ abscission Biological Process
GO:0010434 bract formation Biological Process
GO:0010582 floral meristem determinacy Biological Process
GO:0010865 stipule development Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0048439 flower morphogenesis Biological Process
KEGG gene cross-reference
ath:AT2G41370
lang:109358814
mtr:11417633
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.563
Rank 1 · TkA01G620160 · TK1151
Nucleus0.418
Rank 2 · TkA01G620160 · TK1151
Cell membrane0.121
Rank 3 · TkA01G620160 · TK1151
Lysosome / Vacuole0.069
Rank 4 · TkA01G620160 · TK1151
Golgi apparatus0.050
Rank 5 · TkA01G620160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00651BTB18-57 aa
PF00651BTB88-123 aa
PF00651BTB149-169 aa
PF24521Ank_KRIT1166-192 aa
PF13606Ank_3173-188 aa
PF00651BTB179-205 aa
PF12796Ank_2179-209 aa
PF00023Ank180-187 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G620160PF00651BTB18571.4e-1454.9
TkA01G620160PF00651BTB881231.4e-1454.9
TkA01G620160PF00651BTB1491691.4e-1454.9
TkA01G620160PF24521Ank_KRIT11661920.003717.7
TkA01G620160PF13606Ank_31731882.4e-1040.3
TkA01G620160PF00651BTB1792051.4e-1454.9
TkA01G620160PF12796Ank_21792097.1e-1349.7
TkA01G620160PF00023Ank1801877.9e-1245.4
TkA01G620160PF13857Ank_51972147.4e-1142.9
TkA01G620160PF13606Ank_32012162.4e-1040.3
TkA01G620160PF11900DUF34202092681.1e-1248.5
TkA01G620160PF24521Ank_KRIT12663680.003717.7
TkA01G620160PF13606Ank_32702882.4e-1040.3
TkA01G620160PF13637Ank_42722833e-0731.3
TkA01G620160PF12796Ank_22733567.1e-1349.7
TkA01G620160PF00023Ank2742857.9e-1245.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9ZVC2Arabidopsis thalianasp|Q9ZVC2|NPR5_ARATH Regulatory protein NPR582.200%Swiss-ProtHigh

JBrowse

View in Genome Browser