TkA01G614600 | RubberDandelionOmics

Gene overview

TkA01G614600

Reference: TK1151 Chr: Chr01 Coordinates: 155005163-155009962 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2689 bp · TkA01G614600|TK1151|cDNA

CCGTAGGCCAGTCCTCAAAAGAAATTCCTTCGGTATGAATGCTCTCCACTACGCCCTTCCCCTCGATTCAGTCTGTATATGCAAGCAAAGTCTTTATTTTTCATTTACTTTATATTTTTTTAATCTGTATGTTCTCTCTTCGATACCTCTCTTTCTCTCGCCTGTTTGGTGACCAACTACCCCTGTCTTGGATCCAAAAAAACGAAACTAACCAAGAAAAAACACACACCCTTTTGTTTAATCATTATTTTACAAGTCAT...

CDS

Download CDS FASTA

1602 bp · TkA01G614600|TK1151|CDS

ATGTCGCAAATGGAAGCAGAAAACGGTGATGGCAAGTCGAAGATGGAGGATTATGAGGTTATTGAGCAGATTGGTAGAGGGGCTTTTGGAGCTGCTTTTCTTGTTCTCCATAAGATTGAAAAAAAGAAGTATGTCATGAAGAAGATTCGGTTGAATAAGCAAACAGAGAAGTTTAAGAAGACAGCACATCAAGAGATGGATTTGATGTCTCGACTTGTTCATCCATATGTTGTGGAGTACAAAGATGCTTGGGTGGATAA...

Protein

Download Protein FASTA

533 aa · TkA01G614600|TK1151|PROTEIN

MSQMEAENGDGKSKMEDYEVIEQIGRGAFGAAFLVLHKIEKKKYVMKKIRLNKQTEKFKKTAHQEMDLMSRLVHPYVVEYKDAWVDKVGICIVTAYCEGGDIAELVRKARGAYFPEEKLCKWLTQLLLALDYLHTNRVLHRDLKCSNIFLTKENDVRLGDFGLAKLLNSEDLASSVVGTPNYMCPELLADIPYGYKSDIWSLGCCMFEICAHQQPFRAPDMSGLINKINRSTISPLPIVYSSTLKQIIKTMLRKSPEHRP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G614600`
TK1151 ID	TkA01G614600
OH-1004 ID	LXL04_000392
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G614600

Location Chr01:155005163-155009962 (+)

Description Similar to NEK6: Serine/threonine-protein kinase Nek6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20860`	May be involved in plant development processes.	No verified direct reference in this release
`At3g12200`	May be involved in plant development processes.	No verified direct reference in this release
`At3g44200`	Involved in epidermal-cell morphogenesis in hypocotyls and roots.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0590800`	May be involved in plant development processes.	No verified direct reference in this release
`Os05g0440800`	May be involved in plant development processes.	No verified direct reference in this release
`Os01g0864700`	May be involved in plant development processes.	No verified direct reference in this release
`UniProt: A2ZMH2`	May be involved in plant development processes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000392 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0010311 lateral root formation Biological Process

GO:0010366 negative regulation of ethylene biosynthetic process Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0055028 cortical microtubule Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G12200

ath:AT3G20860

dosa:Os02g0590800

dosa:Os05g0440800

osa:4338922

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.632

Rank 1 · TkA01G614600 · TK1151

Nucleus0.382

Rank 2 · TkA01G614600 · TK1151

Cell membrane0.108

Rank 3 · TkA01G614600 · TK1151

Golgi apparatus0.059

Rank 4 · TkA01G614600 · TK1151

Mitochondrion0.058

Rank 5 · TkA01G614600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase18-270 aa

PF07714PK_Tyr_Ser-Thr20-267 aa

PF03109ABC192-169 aa

PF17667Pkinase_fungal119-201 aa

PF14531Kinase-like125-259 aa

PF17667Pkinase_fungal507-521 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G614600	`PF00069`	Pkinase	18	270	2.5e-68	231.0
TkA01G614600	`PF07714`	PK_Tyr_Ser-Thr	20	267	5.1e-43	147.9
TkA01G614600	`PF03109`	ABC1	92	169	0.00019	21.4
TkA01G614600	`PF17667`	Pkinase_fungal	119	201	0.0015	18.0
TkA01G614600	`PF14531`	Kinase-like	125	259	0.00018	21.6
TkA01G614600	`PF17667`	Pkinase_fungal	507	521	0.0015	18.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LT35`	Arabidopsis thaliana	sp\|Q9LT35\|NEK6_ARATH Serine/threonine-protein kinase Nek6	51.600%	Swiss-Prot	High
`Q9LHI7`	Arabidopsis thaliana	sp\|Q9LHI7\|NEK7_ARATH Serine/threonine-protein kinase Nek7	46.900%	Swiss-Prot	Medium
`Q0WPH8`	Arabidopsis thaliana	sp\|Q0WPH8\|NEK5_ARATH Serine/threonine-protein kinase Nek5	64.500%	Swiss-Prot	High
`Q6YY75`	Oryza sativa subsp. japonica	sp\|Q6YY75\|NEK6_ORYSJ Serine/threonine-protein kinase Nek6	51.700%	Swiss-Prot	High
`Q60DG4`	Oryza sativa subsp. japonica	sp\|Q60DG4\|NEK4_ORYSJ Serine/threonine-protein kinase Nek4	66.900%	Swiss-Prot	Medium
`Q94CU5`	Oryza sativa subsp. japonica	sp\|Q94CU5\|NEK5_ORYSJ Serine/threonine-protein kinase Nek5	72.000%	Swiss-Prot	Low
`A2ZMH2`	Oryza sativa subsp. indica	sp\|A2ZMH2\|NEK2_ORYSI Serine/threonine-protein kinase Nek2	28.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card