RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G613880
Reference: TK1151 Chr: Chr01 Coordinates: 154778777-154782251 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3252 bp · TkA01G613880|TK1151|cDNA

GTTTCCCAACAATATATAAATGAGCTGAATTTGTTTCATTCCATGATATCAACTTTTGTGATGAGCCCTATAAAGTATACAAATGAACTGAATCTGCTTGATTCCATGATATCAAGGGGCTGTAGTAGAATTCAGTCGTAACATGAAGGGCTTAGATGAAACTAACCTTAGTAAATTGGTTGCCCTCTGCATAAGGTATTGCGTAACAAAAGAGACAAACAAACGCTCTGACACACACCCCGACCCTTCAACAACGCACG...

CDS

Download CDS FASTA

2337 bp · TkA01G613880|TK1151|CDS

ATGATGAACATGAACAGACCTCCGAATGAAGATTTCTCGCTCAAAGAGACGAAACCTCACCTCGGTGGAGGAAAAGTCACCGGAGATAAGCTCACAAGCACCTACGACCTCGTCGAACAAATGCAGTACTTATACGTTCGTGTCGTTAAAGCCAAAGATTTACCCACAAAGGACGTCACCGGCAGCTGCGACCCCTACGTCGAGGTCCGAATGGGGAACTACAAAGGAACAACTCGTCATTTCGAGAAGAAAACAAATCC...

Protein

Download Protein FASTA

778 aa · TkA01G613880|TK1151|PROTEIN

MMNMNRPPNEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPTKDVTGSCDPYVEVRMGNYKGTTRHFEKKTNPEWNQVFSFSKDRIQATMLEVTVKDKDLMKDDIMGGVLFDLNEVPKRVPPDSPLAPQWYRLSDRKGDKLKGELMLAVWWGTQADEAFPEAWHSDAAAVSADGLASIRSKVYLSPKLWYLRVNVIEAQDLIPNDRTRFPEVYVKAILGNQALRTRISTSKTINPLWNEDLMFVAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G613880
TK1151 IDTkA01G613880
OH-1004 IDLXL04_000405
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 94.647
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G613880
LocationChr01:154778777-154782251 (+)
DescriptionSimilar to FTIP3: FT-interacting protein 3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g57880 Required for proliferation and differentiation of shoot stem cells in the shoot apical meristem (SAM), thus determining the appropriate balance between the maintenance of shoot stem cells and their differentiation into other aboveground plant parts via the control of subcellular localization and intercellular trafficking of STM in the shoot apex.
FTIP-Dependent STM Trafficking Regulates Shoot Meristem Development in Arabidopsis.2018 · DOI: 10.1016/j.celrep.2018.04.033
At1g51570 Required for proliferation and differentiation of shoot stem cells in the shoot apical meristem (SAM), thus determining the appropriate balance between the maintenance of shoot stem cells and their differentiation into other aboveground plant parts via the control of subcellular localization and intercellular trafficking of STM in the shoot apex.
FTIP-Dependent STM Trafficking Regulates Shoot Meristem Development in Arabidopsis.2018 · DOI: 10.1016/j.celrep.2018.04.033
At5g12970 May function as a signaling molecule by regulating the trafficking of other regulators. No verified direct reference in this release
At4g11610 May function as a signaling molecule by regulating the trafficking of other regulators. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os05g0370600 Promotes nuclear translocation of the transcription factor OSH1, which directly suppresses the auxin biosynthetic gene YUCCA4 during the late development of anthers.
OsFTIP7 determines auxin-mediated anther dehiscence in rice.2018 · DOI: 10.1038/s41477-018-0175-0
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_000405 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009663 plasmodesma organization Biological Process
GO:0009901 anther dehiscence Biological Process
GO:0009908 flower development Biological Process
GO:0009911 positive regulation of flower development Biological Process
GO:0010228 vegetative to reproductive phase transition of meristem Biological Process
GO:0010930 negative regulation of auxin mediated signaling pathway Biological Process
GO:0048574 long-day photoperiodism, flowering Biological Process
GO:0048578 positive regulation of long-day photoperiodism, flowering Biological Process
GO:1902182 shoot apical meristem development Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference
ath:AT1G51570
ath:AT3G57880
ath:AT5G06850
ath:AT5G12970
dosa:Os05g0370600
osa:4338582
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.390
Rank 1 · TkA01G613880 · TK1151
Cell membrane0.349
Rank 2 · TkA01G613880 · TK1151
Cytoplasm0.250
Rank 3 · TkA01G613880 · TK1151
Golgi apparatus0.188
Rank 4 · TkA01G613880 · TK1151
Nucleus0.085
Rank 5 · TkA01G613880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168C243-146 aa
PF00168C2203-309 aa
PF00168C2365-478 aa
PF06398Pex24p513-567 aa
PF08372PRT_C577-616 aa
PF11696DUF3292579-633 aa
PF04842DUF639586-626 aa
PF02453Reticulon595-635 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G613880PF00168C2431462.7e-69230.7
TkA01G613880PF00168C22033092.7e-69230.7
TkA01G613880PF00168C23654782.7e-69230.7
TkA01G613880PF06398Pex24p5135676.3e-0729.5
TkA01G613880PF08372PRT_C5776161.6e-83278.9
TkA01G613880PF11696DUF32925796330.569.3
TkA01G613880PF04842DUF6395866260.1612.1
TkA01G613880PF02453Reticulon5956350.4411.2
TkA01G613880PF06398Pex24p5967596.3e-0729.5
TkA01G613880PF05545FixQ6116170.1612.7
TkA01G613880PF08372PRT_C6237781.6e-83278.9
TkA01G613880PF05545FixQ6256470.1612.7
TkA01G613880PF11696DUF32926847450.569.3
TkA01G613880PF04842DUF6397057440.1612.1
TkA01G613880PF02453Reticulon7087450.4411.2
TkA01G613880PF05545FixQ7217340.1612.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9M2R0Arabidopsis thalianasp|Q9M2R0|FTIP3_ARATH FT-interacting protein 386.600%Swiss-ProtHigh
Q9C8H3Arabidopsis thalianasp|Q9C8H3|FTIP4_ARATH FT-interacting protein 484.400%Swiss-ProtHigh
Q9LXU2Arabidopsis thalianasp|Q9LXU2|MCTP5_ARATH Multiple C2 domain and transmembrane region protein 579.900%Swiss-ProtHigh
Q84TJ7Arabidopsis thalianasp|Q84TJ7|MCTP7_ARATH Multiple C2 domain and transmembrane region protein 768.000%Swiss-ProtHigh
Q60EW9Oryza sativa subsp. japonicasp|Q60EW9|FTIP7_ORYSJ FT-interacting protein 782.200%Swiss-ProtHigh

JBrowse

View in Genome Browser