LXL04_000405 | RubberDandelionOmics

Gene overview

LXL04_000405

Reference: OH-1004 Chr: Chr01 Coordinates: 7518077-7521037 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2606 bp · LXL04_000405|LXL04_000405|OH1004|cDNA

AACAAAAGAGACAAACAAACGCTCTGACACACACCCCGACCCTTCAACAACGCACGCACAAACATCCCCGTTACCGCCTTTGCCTTTTCCTTTTTCTAAAACCCTCCccttctttctctctctaaaaccCACCTCCATTGATTCCacaaaacaacaaacaaaaaaaaccCGTTTCAAATTCCTTCAACATTCCTGCAAATCCTCCCAAGAATCTCCAGACAGCTTCATCAAATCTCCCTGTCATTTTCACTCCTCTTAAG...

CDS

Download CDS FASTA

2469 bp · LXL04_000405|LXL04_000405|OH1004|CDS

TTGATTCCACAAAACAACAAACAAAAAAAACCCGTTTCAAATTCCTTCAACATTCCTGCAAATCCTCCCAAGAATCTCCAGACAGCTTCATCAAATCTCCCTGTCATTTTCACTCCTCTTAAGGAACCCCAGATGATGAACATGAACAGACCTCCGAATGAAGATTTCTCGCTCAAAGAGACTAAACCTCACCTCGGTGGAGGAAAAGTCACCGGAGATAAGCTCACAAGCACCTACGACCTCGTCGAACAAATGCAGTA...

Protein

Download Protein FASTA

822 aa · LXL04_000405|LXL04_000405|OH1004|PROTEIN

MIPQNNKQKKPVSNSFNIPANPPKNLQTASSNLPVIFTPLKEPQMMNMNRPPNEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPTKDVTGSCDPYVEVRMGNYKGTTRHFEKKTNPEWNQVFSFSKDRIQATMLEVTVKDKDLMKDDIMGGVLFDLNEVPKRVPPDSPLAPQWYRLSDRKGDKLKGELMLAVWWGTQADEAFPEAWHSDAAAVSADGLASIRSKVYLSPKLWYLRVNVIEAQDLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000405`
TK1151 ID	TkA01G613880
OH-1004 ID	LXL04_000405
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 94.647 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000405

Location Chr01:7518077-7521037 (-)

Description Similar to FTIP3: FT-interacting protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57880`	Required for proliferation and differentiation of shoot stem cells in the shoot apical meristem (SAM), thus determining the appropriate balance between the maintenance of shoot stem cells and their differentiation into other aboveground plant parts via the control of subcellular localization and intercellular trafficking of STM in the shoot apex.	FTIP-Dependent STM Trafficking Regulates Shoot Meristem Development in Arabidopsis.2018 · DOI: 10.1016/j.celrep.2018.04.033
`At1g51570`	Required for proliferation and differentiation of shoot stem cells in the shoot apical meristem (SAM), thus determining the appropriate balance between the maintenance of shoot stem cells and their differentiation into other aboveground plant parts via the control of subcellular localization and intercellular trafficking of STM in the shoot apex.	FTIP-Dependent STM Trafficking Regulates Shoot Meristem Development in Arabidopsis.2018 · DOI: 10.1016/j.celrep.2018.04.033
`At5g12970`	May function as a signaling molecule by regulating the trafficking of other regulators.	No verified direct reference in this release
`At5g06850`	Involved in the export of FT from the phloem companion cells to the sieve elements through the plasmodesmata.	FTIP1 is an essential regulator required for florigen transport.2012 · DOI: 10.1371/journal.pbio.1001313 Characterization of Multiple C2 Domain and Transmembrane Region Proteins in Arabidopsis.2018 · DOI: 10.1104/pp.17.01144

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0370600`	Promotes nuclear translocation of the transcription factor OSH1, which directly suppresses the auxin biosynthetic gene YUCCA4 during the late development of anthers.	OsFTIP7 determines auxin-mediated anther dehiscence in rice.2018 · DOI: 10.1038/s41477-018-0175-0

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000405 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009663 plasmodesma organization Biological Process

GO:0009901 anther dehiscence Biological Process

GO:0009908 flower development Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0010930 negative regulation of auxin mediated signaling pathway Biological Process

GO:0048574 long-day photoperiodism, flowering Biological Process

GO:0048578 positive regulation of long-day photoperiodism, flowering Biological Process

GO:1902182 shoot apical meristem development Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G51570

ath:AT3G57880

ath:AT5G06850

ath:AT5G12970

dosa:Os05g0370600

osa:4338582

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.363

Rank 1 · LXL04_000405 · OH-1004

Cell membrane0.358

Rank 2 · LXL04_000405 · OH-1004

Cytoplasm0.244

Rank 3 · LXL04_000405 · OH-1004

Golgi apparatus0.192

Rank 4 · LXL04_000405 · OH-1004

Nucleus0.085

Rank 5 · LXL04_000405 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168.37C287-190 aa

PF00168.37C2247-353 aa

PF00168.37C2409-522 aa

PF06398.18Pex24p640-803 aa

PF08372.17PRT_C667-822 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000405	`PF00168.37`	C2	87	190	3.4e-69	230.4
LXL04_000405	`PF00168.37`	C2	247	353	3.4e-69	230.4
LXL04_000405	`PF00168.37`	C2	409	522	3.4e-69	230.4
LXL04_000405	`PF06398.18`	Pex24p	640	803	8.4e-07	29.0
LXL04_000405	`PF08372.17`	PRT_C	667	822	1.9e-83	278.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2R0`	Arabidopsis thaliana	FT-interacting protein 3	86.469%	Swiss-Prot	strong database homology
`Q9C8H3`	Arabidopsis thaliana	FT-interacting protein 4	84.170%	Swiss-Prot	strong database homology
`Q9LXU2`	Arabidopsis thaliana	Multiple C2 domain and transmembrane region protein 5	79.510%	Swiss-Prot	strong database homology
`Q9FL59`	Arabidopsis thaliana	FT-interacting protein 1	67.684%	Swiss-Prot	strong database homology
`Q60EW9`	Oryza sativa subsp. japonica	FT-interacting protein 7	81.572%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card