TkA01G564370 | RubberDandelionOmics

Gene overview

TkA01G564370

Reference: TK1151 Chr: Chr01 Coordinates: 141933313-141933803 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

414 bp · TkA01G564370|TK1151|cDNA

ATGGCAACGCCACCATCCAGTCCAACATCCTCACCCTCACCAACTCCACGCCGGTTCAGATTGGCCGCGCTCTTTACCCCCAGAAGATCCCTACGAAGAATTCGTCGTCGCTCCTTCCGTTCTCCACCTCCTTCATCTTCGCCATGGCTCCCACCAGACACGTTCTTCCAGGCCACGGCGGTTGACGGGAATTCAAGCAATCATGTGTTCGGTGTTGAGTTTGATGTGTTCGCGAATGAAGAGTTTGGGGATATTAATGA...

CDS

Download CDS FASTA

414 bp · TkA01G564370|TK1151|CDS

ATGGCAACGCCACCATCCAGTCCAACATCCTCACCCTCACCAACTCCACGCCGGTTCAGATTGGCCGCGCTCTTTACCCCCAGAAGATCCCTACGAAGAATTCGTCGTCGCTCCTTCCGTTCTCCACCTCCTTCATCTTCGCCATGGCTCCCACCAGACACGTTCTTCCAGGCCACGGCGGTTGACGGGAATTCAAGCAATCATGTGTTCGGTGTTGAGTTTGATGTGTTCGCGAATGAAGAGTTTGGGGATATTAATGA...

Protein

Download Protein FASTA

137 aa · TkA01G564370|TK1151|PROTEIN

MATPPSSPTSSPSPTPRRFRLAALFTPRRSLRRIRRRSFRSPPPSSSPWLPPDTFFQATAVDGNSSNHVFGVEFDVFANEEFGDINDNHVGYFRDQDEGFRRLQLNNGRINSASELELLNFVNLFLVFLIKPISECS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G564370`
TK1151 ID	TkA01G564370
OH-1004 ID	LXL04_009625
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	82.800
Protein coverage (%)	TK1151 56.934 / OH-1004 71.538 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G564370

Location Chr01:141933313-141933803 (-)

Description Similar to LECRK71: L-type lectin-domain containing receptor kinase VII.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04960`	L-type lectin-domain containing receptor kinase VII.1.	No verified direct reference in this release
`At1g53080`	Lectin-like protein At1g53080.	No verified direct reference in this release
`At5g03350`	Plays a positive role in the effector-triggered immunity (ETI) response.	A salicylic acid-induced lectin-like protein plays a positive role in the effector-triggered immunity response of Arabidopsis thaliana to Pseudomonas syringae Avr-Rpm1.2013 · DOI: 10.1094/mpmi-02-13-0044-r Contrasting Roles of the Apoplastic Aspartyl Protease APOPLASTIC, ENHANCED DISEASE SUSCEPTIBILITY1-DEPENDENT1 and LEGUME LECTIN-LIKE PROTEIN1 in Arabidopsis Systemic Acquired Resistance.2014 · DOI: 10.1104/pp.114.239665
`At2g43690`	Probable L-type lectin-domain containing receptor kinase V.3.	No verified direct reference in this release
`At2g43700`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici and to the pathogenic bacteria Pseudomonas syringae.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009625 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G43690

ath:AT2G43700

ath:AT4G04960

ath:AT4G28350

ath:AT4G29050

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.466

Rank 1 · TkA01G564370 · TK1151

Cytoplasm0.295

Rank 2 · TkA01G564370 · TK1151

Endoplasmic reticulum0.127

Rank 3 · TkA01G564370 · TK1151

Cell membrane0.126

Rank 4 · TkA01G564370 · TK1151

Plastid0.103

Rank 5 · TkA01G564370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09224DUF196154-111 aa

PF00139Lectin_legB56-91 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G564370	`PF09224`	DUF1961	54	111	0.029	14.4
TkA01G564370	`PF00139`	Lectin_legB	56	91	3e-08	34.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S9U1`	Arabidopsis thaliana	sp\|Q9S9U1\|LRK71_ARATH L-type lectin-domain containing receptor kinase VII.1	49.200%	Swiss-Prot	Low
`Q9LNN3`	Arabidopsis thaliana	sp\|Q9LNN3\|LECT4_ARATH Lectin-like protein At1g53080	67.700%	Swiss-Prot	Low
`Q9LZF5`	Arabidopsis thaliana	sp\|Q9LZF5\|LECT6_ARATH Lectin-like protein	70.000%	Swiss-Prot	Low
`O22834`	Arabidopsis thaliana	sp\|O22834\|LRK53_ARATH Probable L-type lectin-domain containing receptor kinase V.3	41.300%	Swiss-Prot	Low
`O22833`	Arabidopsis thaliana	sp\|O22833\|LRK54_ARATH L-type lectin-domain containing receptor kinase V.4	68.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card