TkA01G499210 | RubberDandelionOmics

Gene overview

TkA01G499210

Reference: TK1151 Chr: Chr01 Coordinates: 125089894-125091892 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1273 bp · TkA01G499210|TK1151|cDNA

GTATTTATTATAGTACAAAGTTGTTATATTTGTTTCAGAAGAAAGGAAGCAAAAAGTACACCCCCCAACTACCCATACACTCACACAAAAACTCTCTCCCTGTATGAGGTTCTGTTCAATTGAAAATGAGTGTGTGGACTGTGTTTTTCTTCTTGTTTATGTATTGAGCTTCAAAGGTTTCGTTAATGGTGATGAAAAAAAATGTGATTTATTCAAAGGCAGATGGGTATGGGACGATTCAGAATCAAACCAAATGTATA...

CDS

Download CDS FASTA

360 bp · TkA01G499210|TK1151|CDS

ATGGTTGACTCCAACATTACCCTGAAAAGACCCGGTTTTTTTCCAAGGGATTTCTGCTGTTCATTACGAGAGAAGGATTGGGGGGCACCGAATGTGAAGAATTGTGAAGGTCAAACGGCGCCTATACAAGGATTTAGGTATCCAGGAAATAGGTATCCAGGAGAACAAGTGGTGAAAGATGTGATGGGGAAGATGGAAAACCCGGCTTATTTACTGGATATAACATTACTTACACAATTGAGAAAAGACGGGCATCCAGC...

Protein

Download Protein FASTA

119 aa · TkA01G499210|TK1151|PROTEIN

MVDSNITLKRPGFFPRDFCCSLREKDWGAPNVKNCEGQTAPIQGFRYPGNRYPGEQVVKDVMGKMENPAYLLDITLLTQLRKDGHPAKYADGPMDCSHWCLAGVPDTWNQILYTVLLKD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G499210`
TK1151 ID	TkA01G499210
OH-1004 ID	LXL04_016654
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	66.900
Protein coverage (%)	TK1151 98.319 / OH-1004 41.549 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G499210

Location Chr01:125089894-125091892 (+)

Description Similar to TBL42: Protein trichome birefringence-like 42

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78710`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At2g34070`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At1g29050`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At5g58600`	Required for nonhost resistance (NHR) during plant-microbe interactions.	Mutations in PMR5 result in powdery mildew resistance and altered cell wall composition.2004 · DOI: 10.1111/j.1365-313x.2004.02264.x AGB1 and PMR5 contribute to PEN2-mediated preinvasion resistance to Magnaporthe oryzae in Arabidopsis thaliana.2009 · DOI: 10.1094/mpmi-22-11-1331
`At3g14850`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016654 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008374 O-acyltransferase activity Molecular Function

GO:0016413 O-acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G29050

ath:AT1G78710

ath:AT2G31110

ath:AT2G42570

ath:AT3G14850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.237

Rank 1 · TkA01G499210 · TK1151

Extracellular0.212

Rank 2 · TkA01G499210 · TK1151

Lysosome / Vacuole0.181

Rank 3 · TkA01G499210 · TK1151

Golgi apparatus0.146

Rank 4 · TkA01G499210 · TK1151

Cytoplasm0.097

Rank 5 · TkA01G499210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13839PC-Esterase16-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G499210	`PF13839`	PC-Esterase	16	114	2.9e-26	93.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZV89`	Arabidopsis thaliana	sp\|Q9ZV89\|TBL42_ARATH Protein trichome birefringence-like 42	48.800%	Swiss-Prot	Medium
`O22960`	Arabidopsis thaliana	sp\|O22960\|TBL37_ARATH Protein trichome birefringence-like 37	47.000%	Swiss-Prot	Medium
`Q8VY22`	Arabidopsis thaliana	sp\|Q8VY22\|TBL38_ARATH Protein trichome birefringence-like 38	47.900%	Swiss-Prot	Medium
`Q9LUZ6`	Arabidopsis thaliana	sp\|Q9LUZ6\|TBL44_ARATH Protein PMR5	50.000%	Swiss-Prot	High
`F4IWA8`	Arabidopsis thaliana	sp\|F4IWA8\|TBL41_ARATH Protein trichome birefringence-like 41	50.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card