LXL04_016654 | RubberDandelionOmics

Gene overview

LXL04_016654

Reference: OH-1004 Chr: Chr03 Coordinates: 130149558-130152379 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1084 bp · LXL04_016654|LXL04_016654|OH1004|cDNA

ATGTTCAAATCAACTCTGCGTACCACCTTCGCAACCATCTTCTTTCTACTACCGATTCTGATCTCCCAAGCTCACGGCAATGGTGAAGGAAGAAGAATACGAAGACGACAATCAAACGAGTGCGATTTGTTCAAAGGAAGGTGGATTATGGATTCGTCGTACCCGGTCTATAACGGATCTGAATGCCCGTTCGTAGACCCGGGATTGAACTGCCAGAAGAACGGAAGAGATGATACGATGTACCTCAAGTTCAGATGGCA...

CDS

Download CDS FASTA

855 bp · LXL04_016654|LXL04_016654|OH1004|CDS

ATGATACGATGTACCTCAAGTTCAGATGGCAGCCTCAAGGTTGTGCACTTGCGAGATTTAGTGGCAAAAGGTTTTTACGACAAAACCGGGGCAAAAAAAATCATGTTTGTAGGAGACTCACTGAGTTCGAATCAGTGGCAATCATTAGCATGCATGCTTTACCACACGGTTCCTTCCGCCAAACACACCTTCACCCGTCAAGGATCACTCTCAAATCTTTCATTTCCCGAATATGGAGTTTCAATTATGTACCTCAAAAA...

Protein

Download Protein FASTA

284 aa · LXL04_016654|LXL04_016654|OH1004|PROTEIN

MIRCTSSSDGSLKVVHLRDLVAKGFYDKTGAKKIMFVGDSLSSNQWQSLACMLYHTVPSAKHTFTRQGSLSNLSFPEYGVSIMYLKNGFLIDLVVEKQGRVLKLDSISRYGKWEGVDVLIFNSYHWWTHSGSLQTWDYYQVGEEIYKEMARMEAYKIALTTWAIWVDSNINPNKTRVFFQGISAIHDEGKDWNEPNVRTCEGQTLPIRGQYYPGKRYAGQQVVKDVLVKMKNPAYLLDITLLTQLRKDGHPSIYGDEGRD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016654`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016654

Location Chr03:130149558-130152379 (+)

Description Similar to TBL42: Protein trichome birefringence-like 42

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78710`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At3g14850`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At2g42570`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At2g31110`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At1g29050`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016654 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008374 O-acyltransferase activity Molecular Function

GO:0016413 O-acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G29050

ath:AT1G78710

ath:AT2G31110

ath:AT2G42570

ath:AT3G14850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.239

Rank 1 · LXL04_016654 · OH-1004

Extracellular0.187

Rank 2 · LXL04_016654 · OH-1004

Golgi apparatus0.181

Rank 3 · LXL04_016654 · OH-1004

Endoplasmic reticulum0.153

Rank 4 · LXL04_016654 · OH-1004

Cytoplasm0.076

Rank 5 · LXL04_016654 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13839.13PC-Esterase22-279 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016654	`PF13839.13`	PC-Esterase	22	279	5.1e-83	280.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZV89`	Arabidopsis thaliana	Protein trichome birefringence-like 42	56.226%	Swiss-Prot	strong database homology
`F4IWA8`	Arabidopsis thaliana	Protein trichome birefringence-like 41	53.992%	Swiss-Prot	strong database homology
`Q9SIN2`	Arabidopsis thaliana	Protein trichome birefringence-like 39	51.154%	Swiss-Prot	strong database homology
`Q67XC4`	Arabidopsis thaliana	Protein trichome birefringence-like 40	51.351%	Swiss-Prot	strong database homology
`Q8VY22`	Arabidopsis thaliana	Protein trichome birefringence-like 38	52.308%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card