TkA01G458160 | RubberDandelionOmics

Gene overview

TkA01G458160

Reference: TK1151 Chr: Chr01 Coordinates: 114716630-114721296 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2597 bp · TkA01G458160|TK1151|cDNA

CCACAGGCCTTTGTTTTATTTCCCGCGTTTGTAAACATTTCCCGCTTCTCGTCGAAACCCTAATTTGCGAAAAATGGGGACGAAGCACCACTCTTCCGATCCCGTCTCCGATCCTAAAAAGCGTAGAAAGGTCGGATTCTCCAAAGTCGATGAAGGGGTTCAACCTAACGATTGCATTAAAATTTACATGGTTTCTCGTCAAGAGGAAGTTGGCTCTCCAGAAAGCTTCCCTGTTGAACCTGTTGACTTAAGTCCCTTTT...

CDS

Download CDS FASTA

1638 bp · TkA01G458160|TK1151|CDS

ATGGGGACGAAGCACCACTCTTCCGATCCCGTCTCCGATCCTAAAAAGCGTAGAAAGGTCGGATTCTCCAAAGTCGTTTCTCGTCAAGAGGAAGTTGGCTCTCCAGAAAGCTTCCCTGTTGAACCTGTTGACTTAAGTCCCTTTTTTGAAGAAGATGGAAAAATATATGGCTACCAAGGGTTGAAGATCACAATCTGGATTAGCAGCATATCATTTCAAGCATATGCTGATATTTCTTTTGAGAGCACATCTGATAACAT...

Protein

Download Protein FASTA

545 aa · TkA01G458160|TK1151|PROTEIN

MGTKHHSSDPVSDPKKRRKVGFSKVVSRQEEVGSPESFPVEPVDLSPFFEEDGKIYGYQGLKITIWISSISFQAYADISFESTSDNIFADNLVETKDDFLKTFSTESNYIKSMISNGKTIHQNTPSDLEVIRVEGTSMGLLYCRLVPLVLLLVDGSNPIDVTDPDWEVYLLLEKKLDESLKLVGFAALYRFFHYPDSQRLRLGQILVLPPYQRKGYGGHLFETLTNMAVSENIHDLSIEEPLDSLQHIRSCIDIPRLLAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G458160`
TK1151 ID	TkA01G458160
OH-1004 ID	LXL04_002464
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.900
Protein coverage (%)	TK1151 76.514 / OH-1004 99.774 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G458160

Location Chr01:114716630-114721296 (+)

Description Similar to HAG2: Histone acetyltransferase type B catalytic subunit

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56740`	Acetylates soluble but not nucleosomal H4 (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0347800`	Acetylates soluble but not nucleosomal H4.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002464 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0031509 subtelomeric heterochromatin formation Biological Process

GO:0000123 histone acetyltransferase complex Cellular Component

GO:0000781 chromosome, telomeric region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0010485 histone H4 acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G56740

ddi:DDB_G0274269

ddi:DDB_G0275159

dosa:Os09g0347800

zma:542083

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.804

Rank 1 · TkA01G458160 · TK1151

Cytoplasm0.262

Rank 2 · TkA01G458160 · TK1151

Mitochondrion0.037

Rank 3 · TkA01G458160 · TK1151

Cell membrane0.029

Rank 4 · TkA01G458160 · TK1151

Endoplasmic reticulum0.020

Rank 5 · TkA01G458160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13673Acetyltransf_1019-33 aa

PF10394Hat1_N24-154 aa

PF13508Acetyltransf_750-64 aa

PF01853MOZ_SAS117-243 aa

PF13673Acetyltransf_10177-238 aa

PF00583Acetyltransf_1181-236 aa

PF13508Acetyltransf_7181-228 aa

PF10394Hat1_N275-300 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G458160	`PF13673`	Acetyltransf_10	19	33	0.019	15.6
TkA01G458160	`PF10394`	Hat1_N	24	154	4.2e-17	63.5
TkA01G458160	`PF13508`	Acetyltransf_7	50	64	0.00038	21.5
TkA01G458160	`PF01853`	MOZ_SAS	117	243	8.8e-05	22.8
TkA01G458160	`PF13673`	Acetyltransf_10	177	238	0.019	15.6
TkA01G458160	`PF00583`	Acetyltransf_1	181	236	8.4e-07	30.0
TkA01G458160	`PF13508`	Acetyltransf_7	181	228	0.00038	21.5
TkA01G458160	`PF10394`	Hat1_N	275	300	4.2e-17	63.5
TkA01G458160	`PF21183`	HAT1_C	295	316	0.067	14.4
TkA01G458160	`PF10394`	Hat1_N	391	425	4.2e-17	63.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJT8`	Arabidopsis thaliana	sp\|Q9FJT8\|HATB_ARATH Histone acetyltransferase type B catalytic subunit	50.200%	Swiss-Prot	High
`Q6ES10`	Oryza sativa subsp. japonica	sp\|Q6ES10\|HAT1_ORYSJ Probable histone acetyltransferase type B catalytic subunit	48.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card