TkA01G398380 | RubberDandelionOmics

Gene overview

TkA01G398380

Reference: TK1151 Chr: Chr01 Coordinates: 99374414-99376419 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

796 bp · TkA01G398380|TK1151|cDNA

TTTTTTCATGAATTAGGAGTAGACTCTGGTGATATCATATCTGTTCCAAGAGCTGGCAATGTTGGAAAACGAAGTCAACCTGGTACCTTGATCATCAAATTGAAGGTTGCTGAAGACCCTGTTTTTCAAAGAGATGGAGCGGATTTATATGTAGATTCAAATATTGTCTTCACTCAGGCGATTATTGGTGGTAAGGTTGAGGTACCGACTTTGAACGGAAAGACACAAGTAAAGATACCCAAAGGGGTTCAGCATGGTCA...

CDS

Download CDS FASTA

399 bp · TkA01G398380|TK1151|CDS

TTTTTTCATGAATTAGGAGTAGACTCTGGTGATATCATATCTGTTCCAAGAGCTGGCAATGTTGGAAAACGAAGTCAACCTGGTACCTTGATCATCAAATTGAAGGTTGCTGAAGACCCTGTTTTTCAAAGAGATGGAGCGGATTTATATGTAGATTCAAATATTGTCTTCACTCAGGCGATTATTGGTGGTAAGGTTGAGGTACCGACTTTGAACGGAAAGACACAAGTAAAGATACCCAAAGGGGTTCAGCATGGTCA...

Protein

Download Protein FASTA

132 aa · TkA01G398380|TK1151|PROTEIN

FFHELGVDSGDIISVPRAGNVGKRSQPGTLIIKLKVAEDPVFQRDGADLYVDSNIVFTQAIIGGKVEVPTLNGKTQVKIPKGVQHGQLTILRGKGLPRKGLFVDHGDQYVRFRINFPTVVNDRQRAILEEFA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G398380`
TK1151 ID	TkA01G398380
OH-1004 ID	LXL04_038126
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	89.500
Protein coverage (%)	TK1151 100.000 / OH-1004 88.272 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G398380

Location Chr01:99374414-99376419 (+)

Description Similar to ATJ1: Chaperone protein dnaJ 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28210`	Plays a continuous role in plant development probably in the structural organization of compartments.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038126 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000740 nuclear membrane fusion Biological Process

GO:0006260 DNA replication Biological Process

GO:0006457 protein folding Biological Process

GO:0009408 response to heat Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009558 embryo sac cellularization Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0010198 synergid death Biological Process

GO:0042026 protein refolding Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G28210

ath:AT5G48030

avn:Avin_42960

cdf:CD630_24600

pdc:CDIF630_02706

pmy:Pmen_3623

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.415

Rank 1 · TkA01G398380 · TK1151

Mitochondrion0.220

Rank 2 · TkA01G398380 · TK1151

Nucleus0.218

Rank 3 · TkA01G398380 · TK1151

Extracellular0.124

Rank 4 · TkA01G398380 · TK1151

Endoplasmic reticulum0.074

Rank 5 · TkA01G398380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01556DnaJ_C6-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G398380	`PF01556`	DnaJ_C	6	117	1.4e-31	110.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38813`	Arabidopsis thaliana	sp\|Q38813\|DNAJ1_ARATH Chaperone protein dnaJ 1, mitochondrial	70.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card