Gene Card
Gene overview
cDNA / CDS / Protein Sequences
489 bp · LXL04_038126|LXL04_038126|OH1004|cDNA
atgtttttcttttttcatgAATTAGGAGTAGACTCTGGTGATATCATATCTGTTCCAAGAGCTGGCAATGTTGGAAAACGAAGTCAACCTGGTACCTTGATCATCAAATTGAAGGTTGCTCAAGACCCTGTTTTTCAAAGAGATGGAGCGGATTTATATGTAGATTCAAATATTGGCTTCACTCAGGCGATTATTGGTGGTAAGGTTGAGGTACCGACTTTGAACGGAAAGACACAAGTAAAGATACCCAAAGGGGTTCA...
489 bp · LXL04_038126|LXL04_038126|OH1004|CDS
ATGTTTTTCTTTTTTCATGAATTAGGAGTAGACTCTGGTGATATCATATCTGTTCCAAGAGCTGGCAATGTTGGAAAACGAAGTCAACCTGGTACCTTGATCATCAAATTGAAGGTTGCTCAAGACCCTGTTTTTCAAAGAGATGGAGCGGATTTATATGTAGATTCAAATATTGGCTTCACTCAGGCGATTATTGGTGGTAAGGTTGAGGTACCGACTTTGAACGGAAAGACACAAGTAAAGATACCCAAAGGGGTTCA...
Protein
Download Protein FASTA162 aa · LXL04_038126|LXL04_038126|OH1004|PROTEIN
MFFFFHELGVDSGDIISVPRAGNVGKRSQPGTLIIKLKVAQDPVFQRDGADLYVDSNIGFTQAIIGGKVEVPTLNGKTQVKIPKGVQHGQLTILRGKGLPRKGLFVDHRDQYVRFRINFPNDEFKNMRVNFKVVNDRQRAILEEFAKEEIEQAHNMSADGNW
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_038126 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_038126 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr09:31874264-31875536 (+) | |||||||||
| Description | Similar to ATJ1: Chaperone protein dnaJ 1, mitochondrial | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000740 nuclear membrane fusion Biological Process GO:0006260 DNA replication Biological Process GO:0006457 protein folding Biological Process GO:0009408 response to heat Biological Process GO:0009553 embryo sac development Biological Process GO:0009558 embryo sac cellularization Biological Process GO:0010197 polar nucleus fusion Biological Process GO:0010198 synergid death Biological Process GO:0042026 protein refolding Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0009507 chloroplast Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G28210 ath:AT5G48030 avn:Avin_42960 cdf:CD630_24600 pdc:CDIF630_02706 pmy:Pmen_3623 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01556.24DnaJ_C9-120 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_038126 | PF01556.24 | DnaJ_C | 9 | 120 | 1.5e-29 | 103.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.