LXL04_036619 | RubberDandelionOmics

Gene overview

LXL04_036619

Reference: OH-1004 Chr: Chr08 Coordinates: 45526383-45529096 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1836 bp · LXL04_036619|LXL04_036619|OH1004|cDNA

ATGAATCTGAATCTTAAATCGAGAAGCAGAAATCCGAAGGAAACAAGCACATTACCTCTGAAGCGGGCGTCAGGGCTGGAGGAGCGTCGCAGCGAGGGTGGTGCGCCGGTTGAAGGTTGCAGCTCGGAGCTGCAGCTCGGAGCAGAAGCAACACCTATCTGGTCAAAAACTCAAACAATAGGACCCTATATGTTATCATTTCAGCTACCACGAGTACCATTTAAACCGGCCACCCCCCACCACCTCCTCTCCTTTGTCTT...

CDS

Download CDS FASTA

1836 bp · LXL04_036619|LXL04_036619|OH1004|CDS

ATGAATCTGAATCTTAAATCGAGAAGCAGAAATCCGAAGGAAACAAGCACATTACCTCTGAAGCGGGCGTCAGGGCTGGAGGAGCGTCGCAGCGAGGGTGGTGCGCCGGTTGAAGGTTGCAGCTCGGAGCTGCAGCTCGGAGCAGAAGCAACACCTATCTGGTCAAAAACTCAAACAATAGGACCCTATATGTTATCATTTCAGCTACCACGAGTACCATTTAAACCGGCCACCCCCCACCACCTCCTCTCCTTTGTCTT...

Protein

Download Protein FASTA

611 aa · LXL04_036619|LXL04_036619|OH1004|PROTEIN

MNLNLKSRSRNPKETSTLPLKRASGLEERRSEGGAPVEGCSSELQLGAEATPIWSKTQTIGPYMLSFQLPRVPFKPATPHHLLSFVFSNSFMSSFSDQAPPPRTGGLAARISERVGSGVPKFKSIPPPSLPISPPAISPSSYFSIPAGLSPADLLDSPVLLSSSHILPSPTTGSFPFHAFNWKNLSSNIQNHEQSIKKEQKSFTDFSFQQQLNHPTEQLWNQQKQSEHPSQFQSFSPEISTIQTDSNSQTQSFQSGYAAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036619`
TK1151 ID	TkA04G033570
OH-1004 ID	LXL04_036619
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 85.106 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036619

Location Chr08:45526383-45529096 (-)

Description Similar to WRKY24: WRKY transcription factor WRKY24

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38470`	Transcription factor.	Functional characterization of Arabidopsis NaCl-inducible WRKY25 and WRKY33 transcription factors in abiotic stresses.2009 · DOI: 10.1007/s11103-008-9408-3 Arabidopsis thaliana WRKY25, WRKY26, and WRKY33 coordinate induction of plant thermotolerance.2011 · DOI: 10.1007/s00425-011-1375-2 Phosphorylation of a WRKY transcription factor by two pathogen-responsive MAPKs drives phytoalexin biosynthesis in Arabidopsis.2011 · DOI: 10.1105/tpc.111.084996 Arabidopsis sigma factor binding proteins are activators of the WRKY33 transcription factor in plant defense.2011 · DOI: 10.1105/tpc.111.090571 Arabidopsis WRKY33 is a key transcriptional regulator of hormonal and metabolic responses toward Botrytis cinerea infection.2012 · DOI: 10.1104/pp.111.192641
`At5g07100`	Transcription factor.	Arabidopsis thaliana WRKY25, WRKY26, and WRKY33 coordinate induction of plant thermotolerance.2011 · DOI: 10.1007/s00425-011-1375-2

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q6B6R4`	Transcription repressor (By similarity).	No verified direct reference in this release
`Os01g0826400`	May participate in transcriptional regulation of abscisic acid and gibberellin signaling.	Annotations and functional analyses of the rice WRKY gene superfamily reveal positive and negative regulators of abscisic acid signaling in aleurone cells.2005 · DOI: 10.1104/pp.104.054312 A negative regulator encoded by a rice WRKY gene represses both abscisic acid and gibberellins signaling in aleurone cells.2009 · DOI: 10.1007/s11103-009-9463-4

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036619 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT2G38470

ath:AT5G07100

dosa:Os01g0826400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.940

Rank 1 · LXL04_036619 · OH-1004

Cytoplasm0.198

Rank 2 · LXL04_036619 · OH-1004

Mitochondrion0.019

Rank 3 · LXL04_036619 · OH-1004

Cell membrane0.014

Rank 4 · LXL04_036619 · OH-1004

Endoplasmic reticulum0.007

Rank 5 · LXL04_036619 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03106.22WRKY271-327 aa

PF03106.22WRKY442-499 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036619	`PF03106.22`	WRKY	271	327	2.3e-51	172.6
LXL04_036619	`PF03106.22`	WRKY	442	499	2.3e-51	172.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S8P5`	Arabidopsis thaliana	Probable WRKY transcription factor 33	43.182%	Swiss-Prot	moderate database homology
`Q9C5T3`	Arabidopsis thaliana	Probable WRKY transcription factor 26	49.451%	Swiss-Prot	moderate database homology
`Q6B6R4`	Oryza sativa subsp. indica	WRKY transcription factor WRKY24	53.788%	Swiss-Prot	moderate database homology
`Q6IEQ7`	Oryza sativa subsp. japonica	WRKY transcription factor WRKY24	53.788%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card