LXL04_027305 | RubberDandelionOmics

Gene overview

LXL04_027305

Reference: OH-1004 Chr: Chr06 Coordinates: 12959659-12964968 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1779 bp · LXL04_027305|LXL04_027305|OH1004|cDNA

ATGAGTACCACAATCTCTCTTCTTGTGGTGCTATTCACCATCATCAATATTCTATCTTTGAGAAATTGTTATGCGAAGGGTATCACCGCCGTTTTTGTGTTTGGAGACTCTACGGTGGACCCTGGAAACAACAACTACATTCCCACGTATTCCAGAGGGAACTTCCCGCCTTATGGCAAAGATTTCCCCAATCATGAAGCTACCGGAAGGTTCAGCAATGGCCGTCTTGTCACCGATTTTATAACTGAATTCATTGGGGT...

CDS

Download CDS FASTA

1779 bp · LXL04_027305|LXL04_027305|OH1004|CDS

ATGAGTACCACAATCTCTCTTCTTGTGGTGCTATTCACCATCATCAATATTCTATCTTTGAGAAATTGTTATGCGAAGGGTATCACCGCCGTTTTTGTGTTTGGAGACTCTACGGTGGACCCTGGAAACAACAACTACATTCCCACGTATTCCAGAGGGAACTTCCCGCCTTATGGCAAAGATTTCCCCAATCATGAAGCTACCGGAAGGTTCAGCAATGGCCGTCTTGTCACCGATTTTATAACTGAATTCATTGGGGT...

Protein

Download Protein FASTA

592 aa · LXL04_027305|LXL04_027305|OH1004|PROTEIN

MSTTISLLVVLFTIINILSLRNCYAKGITAVFVFGDSTVDPGNNNYIPTYSRGNFPPYGKDFPNHEATGRFSNGRLVTDFITEFIGVKKNLPPYLDPSLTIEDLMTGVSFASAGAGFDPITSQLGKQALVRKAPVRGVAAEVVVVKRAARERVRKCMLSGELATGKCLNQETTLIRAGDTRWSSHFSTLSSLMKLFADVLLVLAFVEEEGGTTDNQRRAAGILKFFTSYEFVFYLYMMYDIFSVTSTLSKQLQRKDLDIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027305`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027305

Location Chr06:12959659-12964968 (-)

Description Similar to At5g45960: GDSL esterase/lipase At5g45960

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45960`	GDSL esterase/lipase At5g45960.	No verified direct reference in this release
`At1g06990`	GDSL esterase/lipase At1g06990.	No verified direct reference in this release
`At2g04570`	GDSL esterase/lipase At2g04570.	No verified direct reference in this release
`At2g42990`	GDSL esterase/lipase At2g42990.	No verified direct reference in this release
`At3g43570`	GDSL esterase/lipase At3g43570.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027305 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0016297 fatty acyl-[ACP] hydrolase activity Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT1G06990

ath:AT2G04570

ath:AT5G45960

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.375

Rank 1 · LXL04_027305 · OH-1004

Cytoplasm0.241

Rank 2 · LXL04_027305 · OH-1004

Endoplasmic reticulum0.148

Rank 3 · LXL04_027305 · OH-1004

Lysosome / Vacuole0.099

Rank 4 · LXL04_027305 · OH-1004

Nucleus0.045

Rank 5 · LXL04_027305 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657.29Lipase_GDSL31-126 aa

PF00657.29Lipase_GDSL439-577 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027305	`PF00657.29`	Lipase_GDSL	31	126	4.7e-17	63.5
LXL04_027305	`PF00657.29`	Lipase_GDSL	439	577	4.7e-17	63.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJ40`	Arabidopsis thaliana	GDSL esterase/lipase At5g45960	67.010%	Swiss-Prot	weak database homology
`Q9LMJ3`	Arabidopsis thaliana	GDSL esterase/lipase At1g06990	51.587%	Swiss-Prot	weak database homology
`Q9SJB4`	Arabidopsis thaliana	GDSL esterase/lipase At2g04570	52.101%	Swiss-Prot	weak database homology
`Q67ZI9`	Arabidopsis thaliana	GDSL esterase/lipase At2g42990	51.695%	Swiss-Prot	weak database homology
`Q9FYD3`	Arabidopsis thaliana	GDSL esterase/lipase At3g43570	46.774%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card