LXL04_024367 | RubberDandelionOmics

Gene overview

LXL04_024367

Reference: OH-1004 Chr: Chr05 Coordinates: 88572524-88576908 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1569 bp · LXL04_024367|LXL04_024367|OH1004|cDNA

ATGGCAACAAACATCGGAATGATGGACGCTGCTTATTTTGTTGGCCGATCAGAGATTCTAGCGTGGATCAATAGCACTCTCCGACTCAATCTCTCCAAGGTCGAGGAGGCATGTTCCGGTGCGGTTCACTGTCAGCTAATGGATGTCGCACATCCTGGTGCCGTGCCGATGCACAAAGTCAATTTTGATGCCAAAACTGAATACGATATGATTCAGAATTACAAGGTTCTGCAAGATGTTTTCAACAAACTCAAGATCAC...

CDS

Download CDS FASTA

1569 bp · LXL04_024367|LXL04_024367|OH1004|CDS

ATGGCAACAAACATCGGAATGATGGACGCTGCTTATTTTGTTGGCCGATCAGAGATTCTAGCGTGGATCAATAGCACTCTCCGACTCAATCTCTCCAAGGTCGAGGAGGCATGTTCCGGTGCGGTTCACTGTCAGCTAATGGATGTCGCACATCCTGGTGCCGTGCCGATGCACAAAGTCAATTTTGATGCCAAAACTGAATACGATATGATTCAGAATTACAAGGTTCTGCAAGATGTTTTCAACAAACTCAAGATCAC...

Protein

Download Protein FASTA

522 aa · LXL04_024367|LXL04_024367|OH1004|PROTEIN

MATNIGMMDAAYFVGRSEILAWINSTLRLNLSKVEEACSGAVHCQLMDVAHPGAVPMHKVNFDAKTEYDMIQNYKVLQDVFNKLKITKHIEVSKLVKGRPLDNLEFMQWMKRYCDSVSGGANPNYNPEGRREACKGGKDMSRKPIRSSSAVPPKSHNSRRVDTPTPNPTAPLPVKNTTVVDTSAYEQQITELKLTMDSLEKERDFYFGKLRDIEILCRLSTMSNVPVILLLPPTYSISIFSEAGKLRFVLQGIEAIKRIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024367`
TK1151 ID	TkA06G152050
OH-1004 ID	LXL04_024367
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.300
Protein coverage (%)	TK1151 94.034 / OH-1004 68.199 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024367

Location Chr05:88572524-88576908 (-)

Description Similar to EB1C: Microtubule-associated protein RP/EB family member 1C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67270`	Plant-specific EB1 subtype that functions preferentially at early stages of plant mitosis by regulating spindle positioning and chromosome segregation.	Nuclear-localized subtype of end-binding 1 protein regulates spindle organization in Arabidopsis.2010 · DOI: 10.1242/jcs.062703
`At2g47170`	GTP-binding protein involved in protein trafficking.	BEX1/ARF1A1C is required for BFA-sensitive recycling of PIN auxin transporters and auxin-mediated development in Arabidopsis.2014 · DOI: 10.1093/pcp/pct196
`At1g70490`	GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.	No verified direct reference in this release
`At1g23490`	GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024367 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0009652 thigmotropism Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0030865 cortical cytoskeleton organization Biological Process

GO:0031001 response to brefeldin A Biological Process

GO:0031110 regulation of microtubule polymerization or depolymerization Biological Process

GO:0035372 protein localization to microtubule Biological Process

GO:0051225 spindle assembly Biological Process

GO:0051301 cell division Biological Process

GO:0090354 regulation of auxin metabolic process Biological Process

KEGG gene cross-reference

ath:AT1G23490

ath:AT1G70490

ath:AT2G47170

ath:AT5G67270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.482

Rank 1 · LXL04_024367 · OH-1004

Golgi apparatus0.405

Rank 2 · LXL04_024367 · OH-1004

Endoplasmic reticulum0.166

Rank 3 · LXL04_024367 · OH-1004

Cell membrane0.164

Rank 4 · LXL04_024367 · OH-1004

Lysosome / Vacuole0.130

Rank 5 · LXL04_024367 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00307.37CH16-107 aa

PF03271.23EB1199-262 aa

PF00025.28Arf347-517 aa

PF09439.17SRPRB356-483 aa

PF08477.20Roc359-469 aa

PF00071.29Ras359-478 aa

PF04670.19Gtr1_RagA359-474 aa

PF00503.27G-alpha385-470 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024367	`PF00307.37`	CH	16	107	5.1e-10	40.2
LXL04_024367	`PF03271.23`	EB1	199	262	8.9e-13	49.0
LXL04_024367	`PF00025.28`	Arf	347	517	2.5e-79	265.5
LXL04_024367	`PF09439.17`	SRPRB	356	483	1.5e-11	44.7
LXL04_024367	`PF08477.20`	Roc	359	469	3.4e-13	50.6
LXL04_024367	`PF00071.29`	Ras	359	478	6.8e-12	46.0
LXL04_024367	`PF04670.19`	Gtr1_RagA	359	474	5e-09	36.6
LXL04_024367	`PF00503.27`	G-alpha	385	470	1.1e-12	48.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGQ6`	Arabidopsis thaliana	Microtubule-associated protein RP/EB family member 1C	52.575%	Swiss-Prot	moderate database homology
`P36397`	Arabidopsis thaliana	ADP-ribosylation factor 1	86.740%	Swiss-Prot	weak database homology
`P0DH91`	Arabidopsis thaliana	ADP-ribosylation factor 2-B	86.740%	Swiss-Prot	weak database homology
`Q9LQC8`	Arabidopsis thaliana	ADP-ribosylation factor 2-A	86.740%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card