LXL04_022604 | RubberDandelionOmics

Gene overview

LXL04_022604

Reference: OH-1004 Chr: Chr05 Coordinates: 2375128-2378105 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2643 bp · LXL04_022604|LXL04_022604|OH1004|cDNA

ATGTATCCTGCATACAGGTGGACAGATTCATACCCATATCACACTAATCCAAGCGCCAAAGAGATGGATCGTGGTATGAATTCACCATACTACCCCTGGCCGTATCCAAGCAGCCATTGTTACCCAACCCCACAGAGTTGCCACTCGTGTTGCAACCATACCTATTTCGGTGGTCCTGCTCCGTACAGTTTCATCCCTCCTTACCCTCACTATccgccgccaccaccgccaccatttcACACCCATGGATTCTATCCTCC...

CDS

Download CDS FASTA

2643 bp · LXL04_022604|LXL04_022604|OH1004|CDS

ATGTATCCTGCATACAGGTGGACAGATTCATACCCATATCACACTAATCCAAGCGCCAAAGAGATGGATCGTGGTATGAATTCACCATACTACCCCTGGCCGTATCCAAGCAGCCATTGTTACCCAACCCCACAGAGTTGCCACTCGTGTTGCAACCATACCTATTTCGGTGGTCCTGCTCCGTACAGTTTCATCCCTCCTTACCCTCACTATCCGCCGCCACCACCGCCACCATTTCACACCCATGGATTCTATCCTCC...

Protein

Download Protein FASTA

880 aa · LXL04_022604|LXL04_022604|OH1004|PROTEIN

MYPAYRWTDSYPYHTNPSAKEMDRGMNSPYYPWPYPSSHCYPTPQSCHSCCNHTYFGGPAPYSFIPPYPHYPPPPPPPFHTHGFYPPPPGAHPAYSFPPPHYSTEQPRYDYDKNTPTPTPTHHHCCGSEKKSTIQPQEPEVDKKTSESLVPFLKDCPYPIMWVPSNYTNTESNAKEKEKENHSHDPVVKPPEPSKQGENEKIPQESFPFPIFWLPSKNNEVKNDMKEDEKTRKNEAEYEKSGKHGVQKVIPVKQLETKEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022604`
TK1151 ID	TkA06G473800
OH-1004 ID	LXL04_022604
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022604

Location Chr05:2375128-2378105 (-)

Description Similar to BAG5: BAG family molecular chaperone regulator 5, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12060`	Co-chaperone that regulates diverse cellular pathways, such as programmed cell death and stress responses.	No verified direct reference in this release
`At2g46240`	Co-chaperone that regulates diverse cellular pathways, such as programmed cell death and stress responses.	AtBAG6, a novel calmodulin-binding protein, induces programmed cell death in yeast and plants.2006 · DOI: 10.1038/sj.cdd.4401712 Dissecting the proteome dynamics of the early heat stress response leading to plant survival or death in Arabidopsis.2016 · DOI: 10.1111/pce.12664 Aspartyl Protease-Mediated Cleavage of BAG6 Is Necessary for Autophagy and Fungal Resistance in Plants.2016 · DOI: 10.1105/tpc.15.00626
`At5g62390`	Co-chaperone that regulates diverse cellular pathways, such as programmed cell death and stress responses.	AtBAG7, an Arabidopsis Bcl-2-associated athanogene, resides in the endoplasmic reticulum and is involved in the unfolded protein response.2010 · DOI: 10.1073/pnas.0912670107

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0719700`	Co-chaperone that regulates stress responses (Probable).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022604 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006914 autophagy Biological Process

GO:0009408 response to heat Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0010508 positive regulation of autophagy Biological Process

GO:0012502 induction of programmed cell death Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0034620 cellular response to unfolded protein Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G12060

ath:AT2G46240

ath:AT5G62390

dosa:Os02g0719700

osa:4330543

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.465

Rank 1 · LXL04_022604 · OH-1004

Nucleus0.439

Rank 2 · LXL04_022604 · OH-1004

Cell membrane0.246

Rank 3 · LXL04_022604 · OH-1004

Endoplasmic reticulum0.097

Rank 4 · LXL04_022604 · OH-1004

Golgi apparatus0.037

Rank 5 · LXL04_022604 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02179.22BAG377-449 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022604	`PF02179.22`	BAG	377	449	1.4e-11	45.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65373`	Arabidopsis thaliana	BAG family molecular chaperone regulator 5, mitochondrial	31.579%	Swiss-Prot	weak database homology
`O82345`	Arabidopsis thaliana	BAG family molecular chaperone regulator 6	48.387%	Swiss-Prot	weak database homology
`Q9LVA0`	Arabidopsis thaliana	BAG family molecular chaperone regulator 7	28.283%	Swiss-Prot	weak database homology
`Q6ZI01`	Oryza sativa subsp. japonica	BAG family molecular chaperone regulator 6, mitochondrial	28.182%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card