TkA06G473800 | RubberDandelionOmics

Gene overview

TkA06G473800

Reference: TK1151 Chr: Chr06 Coordinates: 117190888-117195073 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3121 bp · TkA06G473800|TK1151|cDNA

CTTTATTGGGCCCAGTGTACTTTAATATGTACACGTTGCGACTCGCGAGAAACTGTCTGGAAAGTTCCGTTGGGAAAGAAGCGCGAGAAAGATCTCGAAAGCAGTAGACAACGACGGACAGTATAAATATTGCTCCAATGGAGATTAACAACTCACAGAATCGAATTAAAAAAGAGCAAAGAACAAGCGAGAAGTGCATTCCAGAGCTTTCATTGGGTTGCTGGATTGAGATTGAACTGATATCTGAGTTATTTGGAATT...

CDS

Download CDS FASTA

2643 bp · TkA06G473800|TK1151|CDS

ATGTATCCTGCATACAGGTGGACAGATTCATACCCATATCACACTAATCCAAGCGCCAAAGAGATGGATCGTGGTATGAATTCACCATACTACCCCTGGCCGTATCCAAGCAGCCATTGTTACCCAACCCCACAGAGTTGCCACTCGTGTTGCAACCATACCTATTTCGGTGGTCCTGCTCCGTACAGTTTCATCCCTCCTTACCCTCACTATCCGCCGCCACCACCGCCACCATTTCACACCCATGGATTCTATCCTCC...

Protein

Download Protein FASTA

880 aa · TkA06G473800|TK1151|PROTEIN

MYPAYRWTDSYPYHTNPSAKEMDRGMNSPYYPWPYPSSHCYPTPQSCHSCCNHTYFGGPAPYSFIPPYPHYPPPPPPPFHTHGFYPPPPGAHPAYSFPPPHYSTEQPRYDYDKNTPTPTPTHHHCCGSEKKSTIQPQEPEVDKKTSESLVPFLKDCPYPIMWVPSNYTNTESNAKEKEKENHSHDPVVKPPEPSKQGENEKIPQESFPFPIFWLPSKNNEVKNDMKEDEKTRKNEAEYEKSGKHGVQKVIPVKQLETKEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G473800`
TK1151 ID	TkA06G473800
OH-1004 ID	LXL04_022604
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G473800

Location Chr06:117190888-117195073 (+)

Description Similar to BAG5: BAG family molecular chaperone regulator 5, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46240`	Co-chaperone that regulates diverse cellular pathways, such as programmed cell death and stress responses.	AtBAG6, a novel calmodulin-binding protein, induces programmed cell death in yeast and plants.2006 · DOI: 10.1038/sj.cdd.4401712 Dissecting the proteome dynamics of the early heat stress response leading to plant survival or death in Arabidopsis.2016 · DOI: 10.1111/pce.12664 Aspartyl Protease-Mediated Cleavage of BAG6 Is Necessary for Autophagy and Fungal Resistance in Plants.2016 · DOI: 10.1105/tpc.15.00626
`At1g12060`	Co-chaperone that regulates diverse cellular pathways, such as programmed cell death and stress responses.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022604 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006914 autophagy Biological Process

GO:0009408 response to heat Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0010508 positive regulation of autophagy Biological Process

GO:0012502 induction of programmed cell death Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0034620 cellular response to unfolded protein Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G12060

ath:AT2G46240

ath:AT5G62390

dosa:Os02g0719700

osa:4330543

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.472

Rank 1 · TkA06G473800 · TK1151

Nucleus0.429

Rank 2 · TkA06G473800 · TK1151

Cell membrane0.251

Rank 3 · TkA06G473800 · TK1151

Endoplasmic reticulum0.098

Rank 4 · TkA06G473800 · TK1151

Golgi apparatus0.038

Rank 5 · TkA06G473800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02179BAG324-349 aa

PF27407YubE375-406 aa

PF02179BAG377-449 aa

PF04508Pox_A_type_inc386-396 aa

PF02179BAG515-557 aa

PF27407YubE817-857 aa

PF02179BAG839-854 aa

PF04508Pox_A_type_inc844-853 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G473800	`PF02179`	BAG	324	349	1.4e-11	45.5
TkA06G473800	`PF27407`	YubE	375	406	0.16	12.9
TkA06G473800	`PF02179`	BAG	377	449	1.4e-11	45.5
TkA06G473800	`PF04508`	Pox_A_type_inc	386	396	0.32	11.6
TkA06G473800	`PF02179`	BAG	515	557	1.4e-11	45.5
TkA06G473800	`PF27407`	YubE	817	857	0.16	12.9
TkA06G473800	`PF02179`	BAG	839	854	1.4e-11	45.5
TkA06G473800	`PF04508`	Pox_A_type_inc	844	853	0.32	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82345`	Arabidopsis thaliana	sp\|O82345\|BAG6_ARATH BAG family molecular chaperone regulator 6	25.300%	Swiss-Prot	Low
`O65373`	Arabidopsis thaliana	sp\|O65373\|BAG5_ARATH BAG family molecular chaperone regulator 5, mitochondrial	35.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card