LXL04_021852 | RubberDandelionOmics

Gene overview

LXL04_021852

Reference: OH-1004 Chr: Chr04 Coordinates: 138669809-138672845 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1083 bp · LXL04_021852|LXL04_021852|OH1004|cDNA

ATGAACTGTCCAAAAGACTGGCCGGAGCTAGTTGTCCGGGTTCAATCCCTCTCGGAAACCGGCAACACAATGATCCCAGACCGGTACATCAAACCGCCACCTGAACGGCCGTGTTTTACCGGCGACACCACATTCAACTTAAACATCCCTGTCATCGATCTTTCTGCACTGATGACCGGCGACCCCACACTCGTAAACGCCACCATGGATGAAATCTCCGATGCATGCCGTGAGTGGGGGTTTTTTCAGGTGGTGAATCA...

CDS

Download CDS FASTA

1083 bp · LXL04_021852|LXL04_021852|OH1004|CDS

ATGAACTGTCCAAAAGACTGGCCGGAGCTAGTTGTCCGGGTTCAATCCCTCTCGGAAACCGGCAACACAATGATCCCAGACCGGTACATCAAACCGCCACCTGAACGGCCGTGTTTTACCGGCGACACCACATTCAACTTAAACATCCCTGTCATCGATCTTTCTGCACTGATGACCGGCGACCCCACACTCGTAAACGCCACCATGGATGAAATCTCCGATGCATGCCGTGAGTGGGGGTTTTTTCAGGTGGTGAATCA...

Protein

Download Protein FASTA

360 aa · LXL04_021852|LXL04_021852|OH1004|PROTEIN

MNCPKDWPELVVRVQSLSETGNTMIPDRYIKPPPERPCFTGDTTFNLNIPVIDLSALMTGDPTLVNATMDEISDACREWGFFQVVNHGIRDEVVDGVREIWRSFFHLPMEMKQEYANSPTTYEGYGSRLGFQKGAILDWSDYFFLHYLPSNLKDHNKWPSQPPFLREAVEEYSKEIVKLGNVLLKVFSINLGLEEDYLQKAFGGDNDNIGTCLRVNFYPKCPQPDLTLGLSSHSDPGGMTFLLPDEHVSGLQVRKDGEWI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021852`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021852

Location Chr04:138669809-138672845 (+)

Description Similar to At5g05600: Probable 2-oxoglutarate-dependent dioxygenase At5g05600

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05600`	2-oxoglutarate-dependent dioxygenase involved in the oxidation of jasmonate (JA), a stress-induced phytohormone synthesized in response to attack by pathogens and herbivores, which triggers the activation of defense responses via the JA-mediated signaling pathway.	Detoxification of polycyclic aromatic hydrocarbons (PAHs) in Arabidopsis thaliana involves a putative flavonol synthase.2017 · DOI: 10.1016/j.jhazmat.2016.08.058
`At3g11180`	2-oxoglutarate-dependent dioxygenase involved in the oxidation of jasmonate (JA), a stress-induced phytohormone synthesized in response to attack by pathogens and herbivores, which triggers the activation of defense responses via the JA-mediated signaling pathway.	No verified direct reference in this release
`At3g55970`	2-oxoglutarate-dependent dioxygenase involved in the oxidation of jasmonate (JA), a stress-induced phytohormone synthesized in response to attack by pathogens and herbivores, which triggers the activation of defense responses via the JA-mediated signaling pathway.	No verified direct reference in this release
`At2g38240`	2-oxoglutarate-dependent dioxygenase involved in the oxidation of jasmonate (JA), a stress-induced phytohormone synthesized in response to attack by pathogens and herbivores, which triggers the activation of defense responses via the JA-mediated signaling pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021852 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0097237 cellular response to toxic substance Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

GO:1900366 negative regulation of defense response to insect Biological Process

GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0016706 2-oxoglutarate-dependent dioxygenase activity Molecular Function

GO:0031418 L-ascorbic acid binding Molecular Function

GO:0045431 flavonol synthase activity Molecular Function

GO:0045486 flavanone 3-dioxygenase activity Molecular Function

KEGG gene cross-reference

ag:AAP57395

ath:AT2G38240

ath:AT3G11180

ath:AT3G55970

ath:AT5G05600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.789

Rank 1 · LXL04_021852 · OH-1004

Nucleus0.315

Rank 2 · LXL04_021852 · OH-1004

Peroxisome0.075

Rank 3 · LXL04_021852 · OH-1004

Mitochondrion0.061

Rank 4 · LXL04_021852 · OH-1004

Endoplasmic reticulum0.041

Rank 5 · LXL04_021852 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226.13DIOX_N49-161 aa

PF03171.272OG-FeII_Oxy211-309 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021852	`PF14226.13`	DIOX_N	49	161	5.6e-32	111.6
LXL04_021852	`PF03171.27`	2OG-FeII_Oxy	211	309	1.8e-34	118.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFF6`	Arabidopsis thaliana	Jasmonate-induced oxygenase 2	63.662%	Swiss-Prot	strong database homology
`Q9SRM3`	Arabidopsis thaliana	Jasmonate-induced oxygenase 1	61.732%	Swiss-Prot	strong database homology
`Q9LY48`	Arabidopsis thaliana	Jasmonate-induced oxygenase 3	61.264%	Swiss-Prot	strong database homology
`O80449`	Arabidopsis thaliana	Jasmonate-induced oxygenase 4	56.695%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card